KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329449
Entry
4329449           CDS       T01015                                 
Name
(RefSeq) U6 snRNA-associated Sm-like protein LSm6
  KO
K12625  U6 snRNA-associated Sm-like protein LSm6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4329449
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4329449
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4329449
   03041 Spliceosome [BR:osa03041]
    4329449
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4329449
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     4329449
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    4329449
SSDB
Motif
Pfam: LSM SM-ATX
Other DBs
NCBI-GeneID: 4329449
NCBI-ProteinID: XP_015626012
UniProt: Q6K2E9 A0A8J8YI38
LinkDB
Position
2:complement(18231477..18235795)
AA seq 101 aa
MSSGGEKSGSGGGGGGGGGGAVKTPSDFLKSIRGRPVVVKLNSGVDYRGILACLDGYMNI
AMEQTEEYVNGQLKNKYGDAFIRGNNVLYISTSKRTLTDGA
NT seq 306 nt   +upstreamnt  +downstreamnt
atgagcagtggcggcgagaagtccggctcgggcggcggcggcggtggcggcggcggcggg
gcggtgaagacgccctccgacttcctcaagtccatcagggggcgccccgtcgtcgtcaag
ctcaactccggcgtcgactaccgcggtattttggcttgtcttgatggttacatgaacatt
gcaatggagcaaacggaagaatatgtcaatggtcagctgaagaacaagtacggtgacgct
ttcatacgaggaaacaatgttttatacatcagcacatcaaagcgtaccctcactgatggt
gcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335668
Entry
4335668           CDS       T01015                                 
Name
(RefSeq) U6 snRNA-associated Sm-like protein LSm6
  KO
K12625  U6 snRNA-associated Sm-like protein LSm6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4335668
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4335668
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4335668
   03041 Spliceosome [BR:osa03041]
    4335668
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4335668
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     4335668
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    4335668
SSDB
Motif
Pfam: LSM SM-ATX
Other DBs
NCBI-GeneID: 4335668
NCBI-ProteinID: XP_015636054
UniProt: Q0JDN9 A0A8J8YDN3
LinkDB
Position
4:complement(19135172..19139385)
AA seq 97 aa
MSTGGGADKSGGGGGGAVKTPSDFLKSIRGRPVVVKLNSGVDYRGILACLDGYMNIAMEQ
TEEYVNGQLKNKYGDAFIRGNNVLYISTSKRTLTDDA
NT seq 294 nt   +upstreamnt  +downstreamnt
atgagcaccggcggcggcgcggacaagtccggcggcggcggcggaggggcggtgaagacg
ccctcggacttcctcaagtcgatcaggggacgccccgtcgtcgtcaagctcaactccggc
gtcgactaccgaggtattttggcttgcctggatgggtatatgaacattgcaatggagcaa
acggaagagtatgtgaatggccaactcaagaacaagtatggtgatgccttcataagaggc
aacaatgttctatacatcagcacttcgaagaggacccttacggatgacgcatag

DBGET integrated database retrieval system