KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329509
Entry
4329509           CDS       T01015                                 
Name
(RefSeq) inositol polyphosphate multikinase IPK2
  KO
K00915  inositol-polyphosphate multikinase [EC:2.7.1.140 2.7.1.151]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
Module
osa_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4329509
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4329509
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.140  inositol-tetrakisphosphate 5-kinase
     4329509
    2.7.1.151  inositol-polyphosphate multikinase
     4329509
SSDB
Motif
Pfam: IPK
Other DBs
NCBI-GeneID: 4329509
NCBI-ProteinID: XP_015623153
UniProt: Q6H545
LinkDB
Position
2:19121908..19125851
AA seq 295 aa
MASDLRPPEHQVAGHRASADKLGPLVDGEGLFYKPLQAGERGEHEAAFYAAFTAHPAVPP
RVRGAFFPRFHGTRFLPAPASPGGAPYPHIVLDDLLAGLPSPCVADVKIGACTWPPRSPD
PYVAKCLAKDRETTSALLGFRVSGVRVVDARGGAVWRPDRSELKGIDAAGVRRVLRRYVS
TGGGDGLDCALAAAVYGGEGGVLAQLRELKAWFEEQTLYHFYSASILFGYDANAAAAAAP
GGGSGGVRVKLVDFAHVDDGDGVIDHNFLGGLCSLIKFIGDIVAEVTEKASSDHS
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcctccgacctgcgcccgccggagcaccaggtggcggggcaccgcgcgtccgccgac
aagctgggcccgctcgtcgacggcgaggggctcttctacaagcccctccaggccggggag
cgcggggagcacgaggccgccttctacgccgcgttcaccgcgcacccggccgtcccgccc
cgggtccggggcgccttcttcccgcgcttccacggcacccgcttcctcccggccccagcc
agccccggcggcgcgccctacccgcacatcgtcctcgacgacctcctcgcgggcctcccg
tccccctgcgtcgccgacgtcaagatcggcgcctgcacgtggccgccgcgatccccggac
ccctacgtcgccaagtgcctcgccaaggaccgcgagaccaccagcgcgctcctcggcttc
cgcgtctccggcgtccgggtggtcgatgcccggggcggcgccgtgtggcgcccggaccgg
tcggagctgaaggggatcgacgccgccggggtccgccgcgtgctccgccgctacgtgtcc
acgggcggcggcgacggcctggactgcgcgctcgccgccgcggtgtacggaggggagggc
ggcgtcctggctcagctgcgggagctcaaggcgtggttcgaggagcaaaccctgtaccac
ttctactcggcgtcgattctgttcggctacgacgccaatgcggcggcggcggctgctccc
ggaggtggaagcggcggtgtaagggtgaagctggtggacttcgcgcatgtcgacgatggg
gacggggtgattgaccacaacttcttgggcgggctctgctcgctcatcaagttcatcggc
gacattgtcgccgaggttaccgagaaggcgtcttcagatcattcttga

DBGET integrated database retrieval system