KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329560
Entry
4329560           CDS       T01015                                 
Name
(RefSeq) N-carbamoylputrescine amidase
  KO
K12251  N-carbamoylputrescine amidase [EC:3.5.1.53]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4329560
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.53  N-carbamoylputrescine amidase
     4329560
SSDB
Motif
Pfam: CN_hydrolase
Other DBs
NCBI-GeneID: 4329560
NCBI-ProteinID: XP_015625266
UniProt: Q93XI4
LinkDB
Position
2:19649918..19653396
AA seq 301 aa
MAGGGGAGSKVSVAAVQFACTDVESENVDTAERLIREAHKKGANIVLVQELFEGQYFCQA
QRLDFFQRAKPYKGNPTIIRFQKLAKELEVVIPVSFFEEANNAHYNSVAIIDADGTDLGL
YRKSHIPDGPGYQEKFYFNPGDTGFKAFKTKYATIGVGICWDQWFPECARAMVLQGAEIL
FYPTAIGSEPQDNNLDSREHWKRVMQGHAGANLVPLVASNRIGRETVETEHGESTITFFG
NSFIAGPTGEIVKLANDKDEDVLVAEFDLDEIKSTRHGWGIFRDRRPDLYKVLLTLDGEK
S
NT seq 906 nt   +upstreamnt  +downstreamnt
atggcggggggcgggggcgcggggagtaaggtgtcggtcgccgccgtgcagttcgcctgc
accgacgtcgagtccgagaacgtcgacaccgcggagaggttgataagagaagctcataag
aaaggagcaaacattgtccttgttcaggaactgtttgaggggcagtacttctgtcaagct
caaaggttggacttctttcaacgtgctaagccttataaagggaacccaactataatcagg
tttcaaaaacttgcaaaggagctggaagttgtaatacctgtcagcttttttgaggaggcg
aacaatgcacattacaattcagtagccattattgatgctgatggcactgatcttggcctg
taccgcaaatcacatattccagatggaccaggttatcaagagaaattttatttcaatcct
ggtgacaccggcttcaaggctttcaaaacgaagtatgctacaattggtgttggaatttgt
tgggatcagtggttcccagagtgtgcaagggccatggtgcttcagggggctgaaattttg
ttctatccaactgcaattggttctgagccccaggataataacctagattcccgagaacac
tggaagcgcgtcatgcaaggacatgctggtgctaacctggttccccttgttgcttctaac
aggataggaagggaaaccgttgagactgagcatggtgaaagcactataacattcttcggg
aattcattcatagcagggccaaccggtgaaattgtgaagcttgcaaatgacaaagatgaa
gacgttcttgtagcagagttcgacttggacgagatcaagtctaccaggcatggttggggg
atatttagggaccggcgtcctgatctatataaagtgcttctaacattggatggcgagaaa
tcatga

DBGET integrated database retrieval system