KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329567
Entry
4329567           CDS       T01015                                 
Name
(RefSeq) cysteine and histidine-rich domain-containing protein RAR1
  KO
K13458  disease resistance protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4329567
SSDB
Motif
Pfam: CHORD
Other DBs
NCBI-GeneID: 4329567
NCBI-ProteinID: XP_015623436
UniProt: Q6EPW7
LinkDB
Position
2:complement(19727096..19729887)
AA seq 233 aa
MSTEAETTSAAAPAPAPAPASAPARCQRIGCDATFTDDNNPDGSCQYHPSGPMFHDGMKQ
WSCCKQKSHDFSLFLAIPGCKTGKHTTEKPITKAVPTKPSKAVPVQTSKQSVGADTCSRC
RQGFFCSDHGSQPKAQIPTATSDTNMVPVEKPAVPPPKKKIDLNEPRVCKNKGCGKTYKE
KDNHDEACDYHPGPAVFRDRIRGWKCCDIHVKEFDEFMEIPPCTKGWHNADAA
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtcgacggaggcggagaccaccagcgccgccgcccccgcccccgcccccgcccccgca
tcggcgccggcgcggtgccagcggataggctgcgacgccacgttcaccgacgacaacaac
cccgacggctcctgccaataccacccctccggacctatgtttcatgatggcatgaaacag
tggagttgctgtaagcaaaaaagccatgattttagcctatttttggctattcctgggtgc
aaaactggaaagcacacaactgagaaaccaatcacaaaagcagttcctactaaaccatca
aaggcagttccagtccagacttcgaagcagagtgtgggagctgacacttgctcaaggtgc
cgtcaaggtttcttttgctctgaccatggatcacaacccaaggcacaaataccaaccgct
accagtgatactaacatggtacctgttgagaagcctgcagttccaccaccaaagaaaaaa
attgatctgaatgagcctagggtttgtaagaacaaaggatgtggtaaaacctacaaggag
aaggataatcatgatgaagcatgcgattaccatccaggacctgcagtttttcgcgacagg
attagagggtggaaatgttgtgatattcatgtcaaggaatttgatgaatttatggagatc
cctccgtgcacaaagggttggcacaatgctgatgccgcatga

DBGET integrated database retrieval system