KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329627
Entry
4329627           CDS       T01015                                 
Name
(RefSeq) exosome complex component RRP45A isoform X1
  KO
K03678  exosome complex component RRP45
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4329627
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4329627
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     4329627
SSDB
Motif
Pfam: RNase_PH RNase_PH_C
Other DBs
NCBI-GeneID: 4329627
NCBI-ProteinID: XP_015622943
LinkDB
Position
2:complement(20728286..20731663)
AA seq 449 aa
MDHHQRWHPTVNEREFIERALQSDLRVDGRRPFDFRRLKILFGREDGSAEVQLGDTRVMG
YATAQLVQPYKDRPNEGTLAIFTEFSPMADPAFEPGRPGESAIELGRVVDRGLRESRAVD
MESLCVVAGKHVWSVRVDLHILDNGGNLIDAANIAALAALSTFRRPECTVGGEDGQQVTV
HDPEVRDPLPLTIHHLPIAVTFAYFGEGNIMVIDPTYKEEAVMGGRMTATINSNGDVCSI
QKAGGEGVMSSVIMQCLRIASVKAADITSKIKNEVNSYTSAKALQKVKRLPASALKKDNA
PDVAMKESSDGALETQSTKPSSDGQQINKGDDEDHRNIKRNSSLTVDRTAKQKQTSKFIG
GPSNWDPYSKGVSLSSLRISQLPEPPSVVEDNKQEDVEPMLSECNPEPQSESRLTAGGSD
ETQEAISPKSLKDAVKPKHKIKKKQHSKS
NT seq 1350 nt   +upstreamnt  +downstreamnt
atggaccaccaccagcggtggcaccccacggtgaacgagcgcgagttcatcgagcgcgcc
ctccagtccgacctccgcgtcgacggccgccgccccttcgacttccgccgcctcaagatc
ctcttcggcagggaggacggctcggcggaggtgcagctcggggacacgcgcgtcatgggc
tacgccacggcgcagctggtgcagccgtacaaggacaggcccaacgaggggacgctcgcg
atattcaccgagttctcgcccatggccgaccccgccttcgagccggggcggccaggggag
tcggcgatcgagctcggtcgcgtcgtcgatcgcggcctaagggagagccgagccgtcgat
atggagtccctgtgtgttgttgctgggaagcatgtttggtcggtgcgcgtcgaccttcat
atcttggataatggagggaatctcattgatgcagctaacattgccgcgctggcagctctg
tctactttccggaggcctgaatgtacggtcggaggggaagatggtcaacaggttacagta
catgaccctgaggtaagggacccactccctttgacaattcatcatctccctattgctgtg
acatttgcatattttggcgagggcaacatcatggttattgatccgacatataaggaagaa
gctgttatgggaggacgaatgactgctacaattaactcaaacggtgatgtatgttccatc
cagaaagctggtggagagggtgtcatgtcaagtgttatcatgcagtgtttaagaattgct
tcagttaaagctgctgatataacaagcaaaataaagaatgaggttaactcatacacctct
gcgaaggcactgcagaaagtaaagcgtttgccagcctcagcactgaaaaaggataatgct
cctgatgtggctatgaaggaaagttctgatggtgcattggaaactcaaagtacaaaacca
tccagcgatggtcagcagataaacaaaggtgatgatgaggatcatcgaaatataaaacgg
aattcatccttgactgtggacagaactgctaaacaaaaacaaacatccaaattcattggt
ggtccatcaaattgggatccatactctaaaggagtttcattaagctccctcagaatttct
caattgcctgaaccaccatctgtggttgaggacaacaagcaggaggatgttgaaccaatg
ttatctgaatgtaatcctgagccgcaaagtgaatcaaggttgactgctggagggtcagat
gagacgcaggaagctatatcgccaaagagtctaaaagacgctgtcaagccaaaacacaaa
ataaagaaaaaacaacacagcaagagttaa

DBGET integrated database retrieval system