KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329686
Entry
4329686           CDS       T01015                                 
Name
(RefSeq) DNA repair protein XRCC3 homolog
  KO
K10880  DNA-repair protein XRCC3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4329686
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4329686
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     4329686
SSDB
Motif
Pfam: Rad51 AAA_25 ATPase DnaB_C RecA AAA_22
Other DBs
NCBI-GeneID: 4329686
NCBI-ProteinID: XP_015623888
LinkDB
Position
2:21311539..21317632
AA seq 292 aa
MRPAAPARHPSAAASSSSSTNSQQEPRPENPLLLLPSSRAGKLSLGCPVLDRLLSGGLPP
ASVTEIAGESASGKTQLCLQLALLAPLSPLSASCLFLHSDLPFPLRRLRGLAPKSRPDLL
DHVLVAAAHSPSDLISLLSRAQRLLAHPGRLPPVRLILVDSIASLFRADFDASPADLKRR
SALFFRISAKLKELAHRHRCVVVVTNQVVDVVEGEAGNTVAWSSGRRVSPALGIAWANCV
NTRLFLTRDADGRGCARRRMKVAFAPHLPERACEFVIRRDGVFGVEPSGRCT
NT seq 879 nt   +upstreamnt  +downstreamnt
atgcggccggcggcgccggcaaggcatccgtccgccgccgcctcctcctcctcctccacc
aacagccagcaagagccgcgcccggagaaccccctcctcctcctcccctcctcccgcgcc
ggcaagctctccctcggctgccccgtcctcgaccgcctcctctccggcggcctcccgccc
gcctccgtcaccgagatcgccggcgagtccgcctccgggaagacccagctctgcctccag
ctcgccctcctcgccccgctctccccgctctccgcctcctgcctcttcctccactccgac
ctccccttccccctccgccgcctccgcggcctcgcccccaaatcccgccccgatctcctc
gaccacgtcctcgtcgccgccgcccactccccgtccgacctcatctccctcctctcccgc
gcccagcgcctcctcgcccaccccggccgcctaccccccgtccgcctcatcctcgtcgac
tccatcgcctcccttttccgcgccgacttcgacgcctcgcccgccgacctcaagcgccgc
tccgcgctcttcttccggatatccgcgaagctgaaggagctggcgcacaggcaccggtgc
gtggtggtggtgaccaaccaggtggtggacgtggtggagggggaggccgggaacaccgtg
gcgtggtcgtcggggcgccgggtgagccccgcgctggggatcgcctgggccaactgcgtc
aacacccggctgttcctgacccgggacgcggatggccgcggctgcgcgaggaggcggatg
aaggtggcattcgcgccgcacctgccggagcgggcgtgcgagtttgtgatacggagggac
ggcgtgttcggcgtcgagccgtcgggaaggtgcacctga

DBGET integrated database retrieval system