KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329835
Entry
4329835           CDS       T01015                                 
Name
(RefSeq) DNA mismatch repair protein PMS1 isoform X1
  KO
K10858  DNA mismatch repair protein PMS2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    4329835
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4329835
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     4329835
SSDB
Motif
Pfam: MutL_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 4329835
NCBI-ProteinID: XP_015627645
LinkDB
Position
2:complement(22917843..22924502)
AA seq 929 aa
MAGGSSPAIRPIGKSAVHRICSGQVIFDLSSAVKELVENSLDAGATTVEVTLRSYGEDSF
TVADNGTGISPTNFQALALKHHTSKISDFGDLASVATFGFRGEALSSLCALGKLTVETRT
KDEPVGTRLEFAHSGVVTGERKMARPVGTAVTVEKLFSTLPVRSKEFSRNIRKEYGKVIS
LLNAYALIAKGVRLVCTNTVGKNSKSAVLRTQGSSSLKDNIITVFGLNTFKCLQPFNVTI
SEGCQVDGFLSKPGPGSGRNSGDRQFFYVNGRPVDMPKVSKLVNELYRSSNAKQYPVAVL
NFCIPTTSYDVNVAPDKRKIFFSSEHAILLSLREGIENLYCPQQCSFSINSVEDPGKEMD
PAIDGSDEDMCLTEKENVSAPENDDDMDETDSDDEVTPENQKVPSSVTTRVATGSTPKDV
SPLSRGPPAQLDRSTLLSAYRYEQREKTPTRVKSYPAQANHVRTGLAAKSSPSSAVQPSI
MKFLSQNKRKHEDSCNLISEAPVLRRGTCLEQVRRTDLGVNSPTALTSRVSNIPEVNAPQ
GTNPLRHHSLQSFVPEMPEDSPQHSEPPNIVSHRDEVPQLRPCDVHATESEVDNQHDPCH
SKFGAPSRCSEVEPQNKLTNISLPDAHYDGHDTAAHSGQSSYPVMQFTLADLRRRRRHSF
MISHAKKGSFPEKSTRCYKAATLDNYVPDNEEGKSNSLAAATSELDKLFSKDDFGEMEVV
GQFNLGFIIGKLDQDLFIVDQHAADEKYNFENLSQSTTLNIQPLLQPLRLDLSPEEEVIV
SMNMSTIRKNGFVLAEDLHASPCNRYFIKAVPFSKNITFGAQDVKELISMLADSQGDCSI
ISSYKLDRTDSICPSRVRAMLASRACRMSTMIGDPLTKTEMKKILKNLTGLRSPWNCPHG
RPTMRHLADLHAIKTEVLQNLAGSKATFS
NT seq 2790 nt   +upstreamnt  +downstreamnt
atggccggcggctcgtcgccggcgatacggccgatcggcaagtcggcggtgcaccggatc
tgctccggccaggtcatcttcgacctctcctccgccgtcaaggagctcgtcgagaacagc
ctcgacgccggcgccaccaccgtcgaggtcaccctccgctcctacggcgaggactccttc
accgtcgccgacaacggcaccggcatctcccccaccaatttccaggcgctcgctctgaag
caccacacctccaagatctcggacttcggcgacctcgcctccgtcgccaccttcgggttc
cgcggggaggcgctcagctcgctctgcgcgctggggaagctgacggtcgagacgaggacc
aaggacgagcccgtcgggacgcgcctggagttcgcgcactcgggcgtggtgaccggcgag
aggaagatggcgcggccggtcgggaccgccgtgaccgtcgagaagctgttctccacgctg
ccggtccggagcaaggagttcagcaggaacattcggaaggagtacgggaaagtgatctcc
ttgctgaatgcctatgcgttgattgccaaaggggtcagattagtttgcacaaatactgtt
ggcaagaattctaaatcggcggtgcttaggactcaagggagcagttcactgaaagataat
atcattaccgtatttggtctgaacactttcaagtgcctgcagcccttcaatgtgacaatc
tcagaaggctgccaagttgatggctttctttccaaacctggacctggtagtggtcgcaat
tcaggggatagacagttcttctatgttaatggcagacctgtggatatgccaaaggtttcc
aaacttgtcaatgagctgtacagaagctcaaatgccaagcaataccctgtggctgtattg
aatttctgtattccaaccacatcttatgatgtgaatgttgcgcctgataagagaaaaatt
ttcttctcatctgagcatgccattttgctatctttacgggaaggtattgagaatctgtac
tgccctcaacaatgcagtttctccatcaacagcgttgaagatcctgggaaggaaatggac
ccagccatcgatgggtctgatgaagacatgtgtttaacagaaaaggagaatgtttcagct
cctgaaaatgacgatgacatggatgaaacagatagtgatgatgaggttacaccagagaat
cagaaagtgccttcttcagtgacaacaagggtagccactggatctacacccaaagatgtg
agccccttgtcaagaggcccacctgctcagcttgatagatctactttgctttcagcctac
cggtatgaacaacgagaaaagacgcctacacgagtaaaaagttatccagcacaagcaaat
catgttagaacagggcttgctgcaaagtcttctccttcaagtgctgttcaaccttctatt
atgaaatttctatcacaaaataaaaggaaacacgaagacagttgcaatcttatttctgaa
gctccagtgctgagaaggggaacatgcttggagcaagtgaggagaacagatttaggagtg
aattcaccaactgcactaacctcaagagtatctaatattccagaggttaatgcacctcaa
ggaacaaatcctttgcggcaccattccctgcaatcttttgtacctgagatgccagaagat
tcaccacagcattctgaaccacctaatattgtttctcatcgtgatgaagtgcctcagttg
cgtccatgtgatgttcacgctacagaatctgaagtggataaccagcatgatccatgccat
tccaagtttggtgctcccagtcgatgttcagaagtggaaccccaaaataaactgacaaat
atttccttgcctgatgctcattatgatggtcatgacactgcagcacattctggacaatca
tcttatccagttatgcaatttacacttgctgatcttagaagaagaagaaggcatagtttt
atgatatcacatgcaaaaaaaggaagttttcctgagaaatcaacaaggtgttataaagct
gcgacactggataactatgtaccagataacgaggagggaaaatcgaattctttagctgca
gccaccagcgagttagataagcttttcagtaaagatgactttggagaaatggaggttgtt
gggcagtttaatcttggttttatcattggaaagctggaccaggacctatttattgttgat
cagcatgctgctgatgagaagtacaactttgagaacctttcacagtcaacaactttaaac
atacagcctctccttcaaccactgagacttgacctatcaccagaggaagaagttatcgtt
tctatgaacatgagcactatcagaaagaacggttttgttttagcagaagatctgcatgct
tcaccttgcaaccgctattttataaaagccgttcccttcagcaagaatattacatttggt
gctcaagatgtgaaggagttaatctccatgcttgctgacagtcaaggtgactgttcaata
atcagcagttacaagctcgacagaactgattctatttgtccttcaagggttcgtgctatg
ttggcttcgagggcttgccgaatgtctaccatgataggtgatccattgacaaaaactgag
atgaagaagatacttaagaatttgacaggattgaggtccccttggaattgccctcatggg
aggccaacaatgcgccatctagcagatctccatgctataaaaactgaagtgttgcaaaat
ctcgcaggatcgaaggcaactttctcatga

DBGET integrated database retrieval system