KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329866
Entry
4329866           CDS       T01015                                 
Name
(RefSeq) vacuolar protein sorting-associated protein 20 homolog 2
  KO
K12195  charged multivesicular body protein 6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03250  Viral life cycle - HIV-1
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    4329866
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4329866
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4329866
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4329866
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    4329866
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4329866
  Exosomal proteins of other body fluids (saliva and urine)
   4329866
SSDB
Motif
Pfam: Snf7 TINF2_N DUF5069 Parathyroid PIN_8
Other DBs
NCBI-GeneID: 4329866
NCBI-ProteinID: XP_015623412
UniProt: B9F0V5
LinkDB
Position
2:complement(23159800..23163377)
AA seq 228 aa
MGNIFVKKPKVTDVDRAILTLKTQRRKLAQFQQQLEKVIEAEKEAARQLVQQKKKDRALI
ALKKKKAQEELLKQVDTWQMNVEQQLSDIELASKQKAVFDSLKAGNAALKSIQNEINIDD
VQKLMDDTAEAKAYQDEINAALGEQLSAEDEEAVMAEFENLEAQLAVESLPDAPVTEVRP
EEKSETPAVTEAAEDIDEVIELPDVPTKAPERPEAAEKTKVLEEPLPA
NT seq 687 nt   +upstreamnt  +downstreamnt
atggggaacatcttcgtgaagaagcccaaggtgacggacgtggacagggccatcctcacc
ctcaagacgcagcgccggaagctcgcgcagttccagcagcagcttgagaaggtgattgaa
gcagaaaaggaagctgcacggcagctagttcaacaaaagaagaaagacagagctttgatt
gcactgaagaagaagaaagcacaggaagagctgctgaaacaagttgacacatggcaaatg
aatgtcgaacaacagctgtcagacattgaactagcaagtaaacagaaggctgtatttgac
agcctaaaagctggaaatgctgctcttaagtctatccagaatgagataaatattgatgat
gtccaaaagttgatggacgacacagctgaggccaaggcttaccaagatgagataaatgct
gctctgggtgagcagctatctgctgaggatgaggaggctgttatggctgaatttgagaac
ttggaagcacagcttgccgttgagtctctaccagatgctccagttactgaagtacggcct
gaggagaaatcagaaacacctgctgtcactgaggctgcagaagacattgacgaggttatt
gagcttcctgatgtacccactaaggcaccagagagaccagaagctgcagaaaaaacaaaa
gttttggaagaacccctacctgcatag

DBGET integrated database retrieval system