KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329902
Entry
4329902           CDS       T01015                                 
Name
(RefSeq) pre-mRNA-splicing factor ISY1 homolog
  KO
K12870  pre-mRNA-splicing factor ISY1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4329902
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4329902
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19-related factors
    4329902
 Complex C
    4329902
SSDB
Motif
Pfam: Isy1
Other DBs
NCBI-GeneID: 4329902
NCBI-ProteinID: XP_015625937
UniProt: Q6K5F4 A3A8S8
LinkDB
Position
2:complement(23578398..23580845)
AA seq 311 aa
MARNEEKAQSMLNRFITMKQEEKRKPRERRPYLASECRDLADAERWRSEILREIGAKVAE
IQNEGLGEHRLRDLNDEINKLLRERGHWERRIVELGGRDHSRSSNAPLMTDLDGNIVAIP
NPSGRGPGYRYFGAAKKLPGVRELFDKPPEVRKRRTRYEIHKRINAGYYGYYDDEDGMLE
RLEAVAEKRMRNEVITEWHRVERVRREAMKGVVSGEVASAGGRGGEAAREVLFEEVEEEV
EEERRLEEEKREREKGEEAGKEFIAHVPLPDEKEIERMVLERKKKELLSKYTSDALQVEQ
EEAKEMLNVRR
NT seq 936 nt   +upstreamnt  +downstreamnt
atggcgcgaaacgaggagaaggctcagtccatgctgaaccgcttcatcacgatgaagcag
gaggagaagcggaagccacgggagcggcggccgtacctcgcctccgagtgccgcgacctc
gccgacgccgagcggtggcgctccgagatcctccgcgagatcggcgccaaggtcgccgag
atccagaacgagggcctcggggagcaccgcctccgcgacctcaacgacgagatcaacaag
ctcctccgcgagcgcggccactgggagcgccgcatcgtcgagctcggcggccgcgaccac
tcccgcagctccaacgcgcccctcatgaccgacctcgacggcaacatcgtcgccataccc
aacccctccggccgcggccccgggtaccgctacttcggcgccgccaagaagctccctggc
gtccgtgagctcttcgacaagccacccgaggtccgtaagcggcggacccgctatgagatc
cacaagcgcatcaacgcagggtactacggttactacgacgacgaagacggcatgctagag
cggctcgaggccgttgccgagaagcgcatgcgcaatgaggtcatcactgagtggcaccgt
gtggagcgggtgcggcgggaggccatgaagggggtagtgagcggcgaggtggcctcggca
ggtgggcgcggcggggaggctgctagggaggtgctgttcgaggaggtggaggaggaggtt
gaggaggagaggaggctggaggaggagaagagggagagagagaagggcgaggaggctggg
aaggagtttatcgcgcatgtgccgctacccgatgagaaggagattgagcggatggtgttg
gagcggaagaagaaggagctgctgagcaagtacaccagcgacgccctgcaggttgagcag
gaagaggccaaggagatgctcaatgtgcgccgctag

DBGET integrated database retrieval system