KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329911
Entry
4329911           CDS       T01015                                 
Name
(RefSeq) 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic
  KO
K03526  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [EC:1.17.7.1 1.17.7.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4329911
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.1  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (ferredoxin)
     4329911
    1.17.7.3  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin)
     4329911
SSDB
Motif
Pfam: GcpE Sgf11
Other DBs
NCBI-GeneID: 4329911
NCBI-ProteinID: XP_015625724
UniProt: Q6K8J4
LinkDB
Position
2:complement(23653299..23659199)
AA seq 744 aa
MATGVAPAPLPHVRVRDGGIGFTRSVDFAKILSVPATLRVGSSRGRVLVAKSSSTGSDTM
ELEPSSEGSPLLVPRQKYCESIYETRRRKTRTVMVGNVPLGSDHPIRIQTMTTSDTKDVA
KTVEEVMRIADKGADFVRITVQGRKEADACFEIKNTLVQKNYNIPLVADIHFAPTVALRV
AECFDKIRVNPGNFADRRAQFEQLEYTEDDYQKELEHIEKVFSPLVEKCKQYGRAMRIGT
NHGSLSDRIMSYYGDSPRGMVESALEFARICRKLDFHNFVFSMKASNPVIMVQAYRLLVA
EMYNLGWDYPLHLGVTEAGEGEDGRMKSAIGIGTLLMDGLGDTIRVSLTEPPEEEIDPCR
RLANLGTHAADLQIGVAPFEEKHRRYFDFQRRSGQLPLQKEGEEVDYRGVLHRDGSVLMS
VSLDQLKAPELLYRSLAAKLVVGMPFKDLATVDSILLRELPPVEDAQARLALKRLVDISM
GVLTPLSEQLTKPLPHAIALVNVDELSSGAHKLLPEGTRLAVTLRGDESYEQLDLLKGVD
DITMLLHSVPYGEEKTGRVHAARRLFEYLETNGLNFPVIHHIEFPKSVNRDDLVIGAGAN
VGALLVDGLGDGVLLEAADQEFEFLRDTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE
VSAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVQRGIAM
EGATDALIQLIKDHGRWVDPPVEE
NT seq 2235 nt   +upstreamnt  +downstreamnt
atggccaccggagtggcaccagcgccgctcccacatgtcagggtccgtgatggtggcatc
ggcttcacgaggagcgtcgactttgctaagatcttgtcggttcctgctactctaagggtg
ggctcatcaagaggcagggtgcttgtggccaagagctcaagtaccggttctgataccatg
gagctcgagccatcttcagaaggaagcccacttttagttcccaggcaaaagtattgtgaa
tctatatatgagacaaggaggagaaaaacccgcactgtgatggttgggaatgtgccactt
ggcagtgatcatcccattaggattcagactatgaccacctcggataccaaggatgttgct
aaaaccgtagaggaggttatgaggatagcagataaaggggctgattttgttagaataaca
gtccagggtagaaaggaagctgatgcctgctttgagattaagaacactcttgttcagaag
aattacaacatccccctagtggctgatattcattttgccccgacagttgctttaagagtg
gctgaatgctttgacaaaattcgtgtcaacccagggaattttgctgatcgccgtgcccaa
tttgagcagcttgaatatactgaagatgattatcaaaaagagcttgagcatatcgagaag
gtcttctccccgttggttgagaaatgcaagcagtatggaagagcaatgcgtataggaaca
aatcatggaagtctgtctgaccgcataatgagttactatggtgattctccacgcggaatg
gttgagtctgctttggaatttgccaggatctgtcggaagctggacttccataactttgtg
ttttcaatgaaagcaagtaaccctgttatcatggtccaagcatatcgcttgcttgtagca
gaaatgtataacctagggtgggattatcctttgcacttgggagttacagaagctggagag
ggtgaagatgggaggatgaagtctgccattggcattggaacacttctgatggatggcttg
ggcgatacaatccgtgtctccctcacggaaccacctgaagaagagattgatccttgccgg
agattggcaaatcttggcacacatgccgcagaccttcaaataggagtggctccttttgaa
gaaaagcacaggcgctattttgatttccagcgtagaagtggtcagttgcctttacaaaag
gagggtgaggaagtagactacagaggggtcttgcaccgtgatggctctgttttgatgtca
gtttccttggatcagttgaaggctcctgagctcctttataggtctcttgctgcaaagctt
gtggttggcatgcctttcaaggatctggcaactgtagattctattcttttgagggagctc
ccacctgtagaagatgctcaagctaggcttgcactcaaaagattagttgacatcagcatg
ggtgtgttgactcccttatcagagcaactgacaaagccactcccacatgcaattgctctt
gtcaatgtggatgaactgtcaagcggtgcacacaaacttttgccagaaggcactagattg
gctgtcacccttcgtggagatgaatcatatgaacagctagatcttcttaagggtgttgat
gatataacaatgttactgcacagtgttccttatggtgaagagaagactggcagagtacac
gctgctaggaggttatttgagtacttagaaaccaacggtttgaacttccctgtaatccat
cacatagaattccccaaaagcgtgaacagagatgaccttgttattggtgctggggcaaat
gttggtgctcttctagttgatggtcttggtgatggtgtacttcttgaagctgctgaccag
gaatttgagtttttgagggacacatccttcaacttgttacagggctgcaggatgcgcaac
acaaaaacggaatatgtctcttgtccttcttgtgggcggacactctttgacctccaagaa
gtcagtgctcagattagagagaagacctctcatctgccaggcgtctctattgctatcatg
ggttgcattgtcaatgggccaggggagatggccgatgctgatttcggatacgttggaggt
gctcctgggaagatcgacctttatgttggcaagaccgtcgtgcaacggggcattgcaatg
gagggggccactgacgccttgattcagttaatcaaggaccatggccgttgggtggatcct
cctgttgaggagtag

DBGET integrated database retrieval system