KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329995
Entry
4329995           CDS       T01015                                 
Name
(RefSeq) polyribonucleotide nucleotidyltransferase 2, mitochondrial
  KO
K00962  polyribonucleotide nucleotidyltransferase [EC:2.7.7.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4329995
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4329995
   03016 Transfer RNA biogenesis [BR:osa03016]
    4329995
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.8  polyribonucleotide nucleotidyltransferase
     4329995
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4329995
Transfer RNA biogenesis [BR:osa03016]
 Prokaryotic type
  tRNA degradation factors
   4329995
SSDB
Motif
Pfam: RNase_PH RNase_PH_C PNPase S1 Urease_gamma
Other DBs
NCBI-GeneID: 4329995
NCBI-ProteinID: XP_015625599
LinkDB
Position
2:complement(24531291..24540073)
AA seq 976 aa
MSMAVASLRLLARGGRRRARFPAPLSVPGGRAAFLSGAAEEVAQADAPPPPPPGRKVLES
FREEFEIGGRVISFETGKMARFANGSVVISMDDTHVLSTVAAAKSSEPVRDFLPLTVDYQ
EKQYAQGVIPTTYMRREGAPKERELLCGRIIDRPIRPLFPPGFYHEVQIMVNVISSDGKQ
DPDVMAANASSAALMLSDIPWNGPIGVIRVGRIDGNFVLNPTVDELGLSDLNLVYACSRD
KTLMIDVQAREITERDLQAGMKLAHAEAVKCINPQLRLAKRAGKKKKEYKISLISDKSYE
KIRTLSEAPIEEVFTDSTYGKFERGEALENITQSVKAKLEEECDEDSLKFLHKAVDTVRK
QVIRKRIIEKGLRVDGRQLDEVRPLYCESSTYPILHGSALFSRGDTQVLCTVTLGAPGDA
QRLDSIVGPPTKRFMLHYSFPPFSINEVAKRGGLNRREVGHGTLAEKALLAVLPPEGEFP
YTVRVNSEVMASDGSTSMASVCGGSMALMDAGIPVREHVAGVSVGLVSEVDQTTGDISSY
RILTDILGLEDHLGDMDFKIAGTRRGITAIQLDIKPAGIPLDIICESLEPARKARNQILD
RMDQEISSARAFNDGSSPRLATLSFSSDSLRKLLFHRKKIEQETGARVSVSDGTVTIVAK
TQPIMDKAIEKVEFLVGREIEVGRTYKGVVSSIKEYGAFVEFNGGQQGLLHISELSHDKV
SKVSDVVSVGQVLSLTCIGQDLRGNIKLSLKATLPHAHEKKDLASNHTDPLPSQEVVGWT
AVENMPSKDANAEPSISKDEDNMIEETPGCSTPAVIIRSAAECDAQDVTNDPKKKRPKVA
KSSPKLSKPASERQEVKRTSAKKTSGASTTAKKNKKEKADSSNDVLDAIPEQNKSNIMNY
SSPSNFRSGSMKLGDVVTAKVYQIRAYGLVLELSDGVRGMHKFAENGHKDFEVGEELLVK
CSSFNAKGIPVFSLLD
NT seq 2931 nt   +upstreamnt  +downstreamnt
atgtcgatggcggtggcctccctccgcctcctcgcgcgcggcggccgccgccgcgcccgc
ttccccgcgccgctctccgtcccgggaggccgcgcggcgttcctctccggcgcggccgag
gaggtcgcgcaggcggacgcgccgccgccgccgccgccgggacggaaggtgctggagagc
ttccgcgaggagttcgagatcggtgggcgcgtcatctccttcgagaccgggaagatggcc
cgcttcgccaacggctccgtcgtgatctccatggacgacacccatgtcctctccaccgtc
gccgccgccaagtcctccgaacccgtccgggacttcctcccactgactgttgattatcaa
gagaaacaatatgcccaaggtgttattccgacaacatatatgcggagggaaggtgcccct
aaggaaagggagcttctatgtgggcgtataatcgatcgaccaatacgaccattgtttcct
cctggattttaccatgaagtccagatcatggtaaatgttatatcgtcggatggaaaacaa
gacccagatgtgatggctgcaaatgcctcttcagctgcattaatgctatcggatatacct
tggaatggaccaattggagtaattcgtgtaggaagaattgatggaaattttgtgctgaac
ccaacggtggatgagttaggtttgagtgacctcaaccttgtttatgcgtgttctcgtgat
aaaacattaatgatagatgtgcaagctcgtgagattactgaaagggatcttcaagcagga
atgaaacttgcacacgctgaggcagttaaatgcatcaacccacaacttagattagctaag
agagctggcaaaaagaagaaagagtacaagatctcattgatttcagataaatcctatgag
aaaattagaacattatcagaagcacccattgaagaagtcttcactgattcaacatacggc
aagtttgagcgaggagaagccttggaaaatattacacaatctgtgaaagcaaagcttgaa
gaagaatgcgatgaggacagcttgaagtttcttcacaaggcagttgatacagtgagaaaa
caggttatacgcaaaagaataatcgagaaaggacttagagttgatggcaggcaacttgat
gaagttaggccactctactgtgaatccagcacatatccaatattgcatggatctgccctg
ttttcacgtggggatacacaggttttatgtacagttacccttggtgctcctggtgatgct
cagcgattggattcaattgttggtcctccaacaaagcgtttcatgcttcactacagcttt
ccaccattttcaataaatgaagttgcgaaacgtgggggcttgaatcgacgtgaagttgga
catggcacacttgcggagaaagcattgctcgctgtgcttcccccagaaggtgaatttcca
tatacagttcgggtaaattcagaagtcatggcttctgatggttcaacatcaatggcatca
gtatgtggaggaagtatggctttaatggatgctggaatacctgtaagggaacatgtggct
ggtgtttctgttggtcttgtcagtgaagtggaccagacaactggagatatttctagttat
cgcatattaacggatattttaggtcttgaggatcacttgggtgatatggacttcaaaatt
gcaggaacaaggagaggtattactgctattcaactggatataaaacctgctggaataccg
ttggacataatatgtgaaagtttggaacctgcacgaaaggctcgaaatcaaatccttgac
cgtatggaccaggaaataagttctgcacgtgcttttaatgatgggagctctcctcgatta
gctacactgagcttcagcagtgattctcttaggaaactgcttttccacaggaaaaaaatt
gagcaagaaacaggtgcacgggtatctgttagtgatggtacagtcactattgtagcaaaa
acccaaccaattatggataaggctatcgagaaggtagaatttcttgtgggtcgtgaaatt
gaagttggcagaacgtacaaaggtgttgtttcctcaataaaggagtacggtgcttttgtg
gaattcaatggtggacagcaaggtctacttcatatttctgagttgtcacatgataaggtg
tctaaggtctcggatgttgtatctgttggccaagtgctctcattgacatgcattggacag
gacttgaggggtaacattaaactttctcttaaagctaccctgccccatgcccatgaaaag
aaggatttagcaagtaatcatactgatcctttgccaagtcaagaagttgttggctggacg
gctgtagagaacatgcctagcaaggatgctaatgctgaaccatccatcagcaaagacgaa
gacaacatgattgaggagacacctgggtgttctactcctgcagttataattcgaagtgct
gctgaatgtgatgcgcaagatgttacaaatgatcctaagaagaaacgcccaaaggttgca
aagtcatctcctaagctatctaaaccagccagcgaaaggcaggaagttaagagaactagt
gctaagaaaacttcaggtgcatcaacaacggccaagaaaaataagaaagaaaaagctgac
tcttcaaatgatgtgctggatgccattccagaacaaaataaaagtaacatcatgaactat
tctagtccctcaaacttcaggtctgggtctatgaagctgggtgacgtagttacagcaaag
gtctaccagatacgagcctatggattagtacttgagttgagtgatggagttcgtggaatg
cataaatttgcggaaaatggacacaaggattttgaggtcggagaagaactacttgtgaaa
tgctcaagtttcaatgcaaagggaattccggtcttctcattgctagattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342497
Entry
4342497           CDS       T01015                                 
Name
(RefSeq) probable polyribonucleotide nucleotidyltransferase 1, chloroplastic
  KO
K00962  polyribonucleotide nucleotidyltransferase [EC:2.7.7.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4342497
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4342497
   03016 Transfer RNA biogenesis [BR:osa03016]
    4342497
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.8  polyribonucleotide nucleotidyltransferase
     4342497
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4342497
Transfer RNA biogenesis [BR:osa03016]
 Prokaryotic type
  tRNA degradation factors
   4342497
SSDB
Motif
Pfam: RNase_PH RNase_PH_C S1 KH_1 PNPase KH_2
Other DBs
NCBI-GeneID: 4342497
NCBI-ProteinID: XP_015647677
UniProt: Q69LE7
LinkDB
Position
7:complement(3645695..3672756)
AA seq 902 aa
MLATPGALHHLLLLPPPPHTQLAFHHAVGGVPAALLPLPRPRRVAASASTSRRGGARRRA
AGARVRASVGEEAPPVVTEEASTSGGPTKFSTKIPVGDRHILVETGHIGRQASASVMVTD
GETIVYSSVCLADTPNDPSDFFPMSVHYQERLSAAGRTSGGFFKREGRAKDHEVLVCRLI
DRPLRPTMPKGFYYETQILSWVFSYDGIHSPDSLAITAAGVAMALSEVPNKQTIAGVRVG
MINDQFVVNPTTEQMDDSELDLVMAGTDSAILMIEGYCDFLTEEKLLQAVETGQGAIREI
CKAIDGLVQKCGKKKMFDAIDLPPPELYRHVEDISGDELVKALQIKEKILRRKALSALEE
KVITILSEQGYVAKDESSGVSENLADVIEEEDEDEVIVDGEVDEGEVHIKPVSRKPPRQL
FSEVDVKLVFKEVSSKFLRRRIVEGGKRSDGRSPCELRPINSQCGLLPRAHGSALFTRGE
TQALAVVTLGDYQMAQRIDNLVDTEESKSFYLQYTFPPSSVGEVGRIGAPNRREIGHGML
AERALEPILPPEEDFPYTIRVESTITESNGSSSMASVCGGCLALQDAGVPIKFPVAGIAM
GLVLDTLEFGGDGKPLILSDITGAEDASGDMDFKVAGNENGISAFQMDIKVVGITLPIME
HALLQARDGRKHILNEMSKCSPPPAKVLSPYAPLIHVMKVKPNKVNLIIGSGGKTIKSII
EETGVDAIDTGDDGTVKITARDLSSLEKSKAIIANLTMVPKVGEIYRNCEIKTIAPYGAF
VEIAPGREGLCHISELSSSWLAKAEDAFKVGDRIDVKLIEINDKGQLRLSSRALLPDANQ
ESSSKQQAGGSTREKAPQKDNLVKMTTRRPRRKKQAEASTAENNATASPKDLASQGSEMG
TE
NT seq 2709 nt   +upstreamnt  +downstreamnt
atgctcgcgacccccggcgcgctccaccacctcctcctcctcccgccgccgccgcacacg
caactcgccttccaccatgccgtcgggggcgtccccgcggcgctgctcccgctcccccgc
ccccgccgcgtagcagcgagcgcctccacctcgcgtcgcggtggcgcgcgaaggagagcg
gcgggggctagggttagggcttccgtgggcgaggaggcgccccccgtggtgaccgaggag
gcgagcacctccggcggcccgaccaagttctccacgaagattcccgtcggcgaccgccac
atactggtggagacaggccacatagggaggcaagcaagcgcttctgtaatggtcacggat
ggcgaaacaattgtttactcctccgtctgtcttgctgatacaccaaacgatccttctgat
tttttcccaatgtcagttcactatcaagaacgcctttcagctgctggaagaactagtggt
ggtttctttaaacgagaaggaagggcaaaagaccatgaggttttagtatgcagattgata
gataggcccctacgccctactatgcccaagggcttctactacgaaactcagattctatcc
tgggttttcagttatgatggtattcattcccccgatagcttggctatcacagctgctggt
gtagccatggcactctctgaagttccaaataaacaaacaattgctggagtgagagttggt
atgatcaatgatcagtttgttgttaacccaaccactgaacaaatggatgactcagagttg
gacttggtgatggctgggaccgatagtgccatactgatgatagagggctattgtgatttt
ctaactgaggagaagctacttcaagctgtggaaactgggcagggggcaattcgagaaatc
tgcaaagcaattgatggtcttgtccagaaatgtggaaagaagaaaatgttcgatgctatc
gacttaccaccccctgaactctacaggcatgttgaagatatttctggagatgagttggtg
aaggcgctgcaaataaaagagaagatcctcagaagaaaagctctttcagcattggaggag
aaagtaataacaatactttctgaacaaggatatgttgctaaagatgagtcatctggagtc
agtgaaaatttagctgatgtaattgaagaagaggatgaggatgaagttatagtggatggt
gaagtggatgaaggtgaagttcatatcaagccagtatcaaggaaacccccacgtcagtta
ttctcagaagttgacgtcaagctagtcttcaaggaagtttcatccaaatttttacggaga
cggattgtagagggtggaaagcgaagtgatggaaggagtccttgtgagcttcgtcccatt
aattctcaatgtggattacttcctcgagcacatggtagtgcactattcacaaggggagaa
acccaggcactggctgtggtcactttaggtgactatcagatggcacagcgaattgataac
cttgttgatactgaggaatcgaaaagtttctatcttcagtacacatttcctccatcatct
gttggtgaagttggtcgaattggagcacctaataggagggagataggacatggaatgctt
gcagaaagagccctggaaccaattttacctcctgaagaggattttccttacactattcga
gttgagagtactatcaccgaaagtaatggctcctccagcatggcttctgtctgtggaggt
tgtttagcacttcaagacgctggtgttccaataaagttccctgttgctggaatagcaatg
ggcttggttcttgatacactggaatttggtggagatggcaagccacttattctctctgat
attacgggtgctgaagatgcctctggtgatatggattttaaggttgctggtaatgaaaat
ggtatatctgctttccaaatggacatcaaggtagtggggataactctgcctataatggaa
cacgcccttcttcaagctagagatggtagaaaacatattttaaatgaaatgtcaaaatgt
tcacctccaccagcaaaagtactctctccatacgctcccttaatccatgtcatgaaggtc
aagccaaacaaggtgaatttaataattggttctggtggaaagacgataaaaagcataatt
gaggagactggcgttgatgctattgacactggagatgatggcacagtaaaaattaccgct
agggacttatcaagcttagagaagtcaaaagctataattgctaaccttaccatggttcca
aaagttggagaaatttacaggaactgcgagatcaaaacaattgcaccatatggagctttt
gttgaaattgcaccagggcgtgagggtttatgccatatcagtgagttaagttcgagttgg
ttggccaaggctgaggatgctttcaaagtcggcgatcgcattgatgtcaagctaattgag
ataaatgacaagggtcaacttcgcctaagttctcgagccttactgcctgatgcaaatcaa
gaatctagcagcaagcaacaagcaggtggttcaactagggagaaggcaccacagaaggat
aatcttgttaagatgacaacaagaagacccagacgtaagaagcaagcagaggcatctaca
gctgaaaacaatgcaactgcttcaccgaaggatttggcttcacaaggcagcgaaatggga
acggaatag

DBGET integrated database retrieval system