KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330000
Entry
4330000           CDS       T01015                                 
Name
(RefSeq) two-component response regulator-like PRR1
  KO
K12127  pseudo-response regulator 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4330000
SSDB
Motif
Pfam: CCT Response_reg Jas_motif
Other DBs
NCBI-GeneID: 4330000
NCBI-ProteinID: XP_015626003
UniProt: Q689G9
LinkDB
Position
2:24569299..24572523
AA seq 518 aa
MVGAGEGDRVGGGAAVGGGQQFVDRSKVRILLCDSDPSSSREVLRLLCNCSYQVTCAKSP
RQVINVLNCEAGEIDIILAEVDLPVSKCFKMLKYIARNKELRHIPIIMMSNRDEVSVVVK
CLRLGAAEYLVKPLRMNELLNLWTHVWRRRRMLGLSEKNFFNDNFELALSEPSDANTNST
TLLSDDTDDKPKENINQETSTSNQHEYESNPSDAEPKQKGTPEGLLVSTEGGDQASSPGV
MFSRPIKTNLRVAESSAFLAYVKSSTPTTSSFDSELQKGGNRLDSSDHRGNFSSTTDRSD
TGTDVNIRDKEAFEMPVQYPVVCFSSSNLHLERSNEGQNDASGTPPVYHFPFYYPGMMDH
GMTHPPVQNFQGNINNAQVHTPQTLLPQYNVYPQCHGVSMMPPFQYNPAGMSIQSNQLPT
QNMWPQASSTPMPEETCSRSERRAAALAKFRLKRKERCFDKKVRYVNRKKLAETRPRVRG
QFVRQANYTDITSTGDDISEDEDDDPSSREVEMVSSPE
NT seq 1557 nt   +upstreamnt  +downstreamnt
atggtgggcgccggcgagggggatcgcgttggcggcggggcggcggtagggggagggcag
cagttcgtggaccggagcaaggtgaggattctgctctgcgacagcgacccaagtagctca
cgggaggtgctccgcctcctctgcaactgctcataccaagtgacttgcgccaagtctccg
aggcaggtgatcaacgtactcaactgcgaggcgggggagatcgacatcatcttggccgag
gtcgatctgcccgtctccaagtgcttcaagatgctcaaatacatcgccaggaacaaggaa
ttgcgccacatccccatcataatgatgtccaacagagacgaggtctctgttgttgtcaag
tgcttgcgtctcggggcagccgagtacctggtcaagccactgcgcatgaacgagctgctg
aacctctggacccatgtgtggcggcgaaggcggatgcttggtttgtcggagaaaaacttc
ttcaatgacaatttcgagttggcgttatcggaacctagtgacgccaataccaacagcacc
actcttctctcggatgacacagatgataagccaaaagaaaacattaatcaagaaacaagc
acctcgaatcaacatgaatatgagtctaatccttctgatgctgagcctaaacaaaaaggc
acaccagagggtttactagtctctactgaaggcggcgaccaagcttcatctcccggagta
atgttttcacgtccaataaagactaacttgagggttgctgagtcttctgcttttctagct
tatgttaagtcaagcaccccaactaccagctcatttgacagcgaactacaaaaaggtgga
aatcggttagactcttcggatcacaggggtaatttctctagtacaactgacagaagtgac
actggcactgatgtaaatattcgggataaagaagcctttgagatgccagtgcaataccct
gtggtatgcttttcttcctctaacttgcatctggagcgaagcaatgaaggccaaaatgat
gcttcaggaactcctcctgtatatcattttcccttttattacccagggatgatggaccac
ggtatgacacatcctccggtgcaaaatttccaagggaacataaacaacgctcaagtgcat
acaccacaaacgttgctccctcagtataatgtttatccccaatgtcatggtgtatctatg
atgccaccatttcagtataatcctgctggtatgagcattcaatcaaatcaactgccaaca
caaaatatgtggccacaggcatcaagcacaccaatgcccgaggaaacatgtagtcggtct
gaacggagagctgcagcacttgccaaattcaggctgaaaaggaaggaacgttgttttgac
aagaaggtgaggtacgtgaataggaagaaacttgctgaaacaaggccgagggtgcgaggg
caatttgttagacaggcaaactatacagatataaccagcactggagatgatatctcagaa
gatgaagatgatgatccatcctccagggaggtagagatggtttcttctccagagtag

DBGET integrated database retrieval system