KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330032
Entry
4330032           CDS       T01015                                 
Name
(RefSeq) adenosine kinase 2
  KO
K00856  adenosine kinase [EC:2.7.1.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4330032
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.20  adenosine kinase
     4330032
SSDB
Motif
Pfam: PfkB Phos_pyr_kin Glycogen_syn
Other DBs
NCBI-GeneID: 4330032
NCBI-ProteinID: XP_015626684
UniProt: Q6K1R5 A0A8J8XRV2
LinkDB
Position
2:complement(24940846..24946672)
AA seq 341 aa
MASEGVLLGMGNPLLDISAVVDDAFLTKYDVKLNNAILAEEKHLPMYDELASKGNVEYIA
GGATQNSIRVAQWMLQTPGATSYMGCIGKDKFGEEMKKNAQAAGVTAHYYEDEAAPTGTC
AVCVVGGERSLVANLSAANCYKSEHLKKPENWALVEKAKYIYIAGFFLTVSPDSIQLVAE
HAAANNKVFLMNLSAPFICEFFRDAQEKVLPFVDYIFGNETEARIFAKVRGWETENVEEI
ALKISQLPLASGKQKRIAVITQGADPVVVAEDGQVKTFPVILLPKEKLVDTNGAGDAFVG
GFLSQLVQQKSIEDSVKAGCYAANVIIQRSGCTYPEKPDFN
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggcgtccgagggcgtgctcctggggatgggcaaccccctcctcgacatctccgccgtc
gtcgacgacgccttcctcaccaagtatgacgtcaagctgaacaatgcaattctcgctgag
gaaaagcacttgcctatgtatgatgagttggccagcaagggcaatgttgaatatattgcc
ggaggagccacccagaactctatcagggttgctcaatggatgcttcaaactcctggtgca
acaagttacatgggttgcattggaaaggataagtttggtgaggagatgaagaagaatgcc
caagctgctggtgttactgctcattactacgaggatgaggctgctcccacgggcacatgt
gctgtctgtgttgttggtggtgaaagatcactggttgcaaacttatcagcagcaaactgc
tacaaatctgagcatctgaagaaaccggagaactgggcactagtggagaaagcaaaatac
atctacattgctggctttttccttacggtctccccagattctattcagcttgttgctgag
catgctgccgctaacaacaaggtgttcctgatgaacctctctgcaccctttatctgtgag
tttttccgtgatgcccaggagaaggttcttccgtttgtggactacatcttcggtaacgaa
acagaagcaagaatctttgctaaagtccgtggatgggagactgagaatgttgaggagatc
gcgttgaagatttcccagcttccattggcctctggaaaacaaaagaggattgccgtgatt
actcaaggtgctgatccagtagttgtcgctgaggatggacaggtgaaaacattccctgtg
atcctactgccaaaggagaagcttgttgacaccaatggcgctggtgatgcctttgttgga
ggcttcctctcacaattggttcaacaaaagagcattgaggactctgtgaaggctggttgc
tatgccgcaaatgttatcatccagcgttctggctgcacttaccctgagaagcctgatttc
aactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336412
Entry
4336412           CDS       T01015                                 
Name
(RefSeq) adenosine kinase 2
  KO
K00856  adenosine kinase [EC:2.7.1.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4336412
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.20  adenosine kinase
     4336412
SSDB
Motif
Pfam: PfkB Glycogen_syn
Other DBs
NCBI-GeneID: 4336412
NCBI-ProteinID: XP_015633952
UniProt: A0A0P0WCG2 Q0JBQ0
LinkDB
Position
4:complement(25898093..25902372)
AA seq 344 aa
MESGSYEGVLLGMGNPLLDISAVVDEAFLAKYDIKPGNAILAEEKHLPMYNELASKVNVE
YIAGGSTQNSIRVAQWMLQIPGATSYMGCIGKDKFGEEMKKDAQTAGVNAHYYEDDNAPT
GTCAVCIVGGERSLVANLSAANCYRSEHLKRPENWTLVEKAKYIYIAGFFLTVSPDSIQL
VAEHAAATNKVFMMNLSAPFICEFFRDAQEKALPYADYIFGNETEARTFAKVRGWETENT
EEIALKISQLPKASGAHKRITVITQGCDPVVVADDGKVKTFPVIVLPKEKLVDTNGAGDA
FVGGFLSQLVQEKSIDECVRAACYAANVIIQRSGCTYPEKPDFN
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggagagcggaagctacgagggcgtcctcctgggcatgggaaaccccctcctcgacatc
tccgccgtcgtcgacgaggccttcctcgcaaaatatgatatcaagccagggaatgcaatt
ctagcagaggagaagcatttgcctatgtacaatgaattggctagcaaggtcaatgttgaa
tatatcgctggaggatccactcaaaattctattagggttgctcagtggatgctccagatt
cctggtgcaacaagttacatgggttgcattgggaaggacaagttcggtgaggagatgaag
aaagacgcacaaaccgctggtgttaatgcccattattatgaggatgataatgctcctact
ggcacatgtgctgtctgcattgttggtggtgaaaggtcacttgttgcaaacttgtctgca
gcgaactgctacaggtctgaacatctgaagaggccagagaactggacacttgttgagaag
gcaaaatatatttacattgctggctttttcctcacggtatccccggattccattcaactt
gttgctgagcatgctgctgcaactaacaaggtgtttatgatgaacctttctgctcccttt
atatgtgaattcttccgtgatgcccaagagaaggctcttccgtatgctgactatattttt
ggaaatgaaactgaagcaaggacctttgctaaagttcgtggttgggagactgagaatact
gaggagattgctttgaagatctcgcaattgcctaaggcttcaggagcacacaagaggatt
actgtcattactcaaggctgtgacccagtagttgtggctgatgatggaaaggtcaaaaca
ttccctgttatcgttttgcccaaggaaaagcttgttgacaccaatggtgcaggcgatgcc
tttgttgggggttttctctctcaattggttcaggagaagagcattgatgaatgtgtcaga
gctgcttgttatgctgcaaacgttatcatccaacgctcaggctgcacttaccctgagaag
cctgacttcaactag

DBGET integrated database retrieval system