KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330068
Entry
4330068           CDS       T01015                                 
Name
(RefSeq) replication protein A 32 kDa subunit B isoform X2
  KO
K10739  replication factor A2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4330068
   03420 Nucleotide excision repair
    4330068
   03430 Mismatch repair
    4330068
   03440 Homologous recombination
    4330068
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4330068
   03400 DNA repair and recombination proteins [BR:osa03400]
    4330068
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    4330068
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     4330068
   MMR (mismatch excision repair)
     4330068
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     4330068
SSDB
Motif
Pfam: RPA_C tRNA_anti-codon RMI2 SnoaL_4 PCI
Other DBs
NCBI-GeneID: 4330068
NCBI-ProteinID: XP_015625648
UniProt: Q6H7J5 A0A7D5BIZ9
LinkDB
Position
2:complement(25404409..25408583)
AA seq 298 aa
MYGVGVGGGGGGNYDGGGGNASSLFGGGGFMPSQATNAAEGTSGGGGGFPKSRNAQALLP
LTVKQIMDASQTNDDKSNFAVNGMEVSTVRLVGRMLNKLDRVTDVSFTLDDGTGRVPVNR
WENDSTDTKEMADIQNGDYVIVNGGLKGFQGKRQVVAYSVRRITNFNDVTHHFLHCVHVH
LELTRPKSQVNANTATGTPNQTMPRDSMAYNQSPLTNQASTFSAPQNTGTGTNMIDLVLN
VFHDPAVMNDDHGVGVDYVSRRLNLPEETVGKIIIDQVDLGHLYATIDDHHYKSTMNG
NT seq 897 nt   +upstreamnt  +downstreamnt
atgtacggcgtcggcgtcggcggcggcggcggcgggaactacgatggcgggggagggaac
gccagctccctcttcggcggcggcggattcatgccctcgcaggcgaccaacgccgcggag
gggaccagcggcggcggcggcggcttccccaagagtcggaacgcccaggcgctgctcccg
ctcaccgtgaagcagatcatggacgcgtcccagaccaacgacgacaagtcgaattttgct
gtcaatggcatggaggtgtccacggttaggcttgtaggacgcatgttaaataagcttgat
cgggttacggatgtatcattcactcttgatgatggtacaggcagggtacctgtgaatcgc
tgggaaaacgatagcactgatactaaggagatggctgacattcagaatggtgactatgtt
attgtcaatggtggtctaaaaggttttcaagggaagcgtcaggtggttgcttactctgtg
aggcgtataaccaacttcaatgatgtaacacatcactttcttcactgcgttcatgtgcac
ttggagcttaccaggccgaagtcccaagtaaatgctaatacagcaacaggaactcctaac
caaactatgcctagggatagcatggcgtataaccaaagtccacttactaatcaggcctca
acattttctgcaccacaaaatactggtactggaacaaatatgatcgacttggtcttgaat
gtttttcatgacccagcagttatgaatgatgaccatggagtaggcgtagattatgtgagc
cgtcgtcttaatctaccagaggaaacagtcgggaaaatcattatagaccaagttgatctg
ggacatttgtatgccactatcgatgaccaccattacaagtccacaatgaatggttga

DBGET integrated database retrieval system