KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330097
Entry
4330097           CDS       T01015                                 
Name
(RefSeq) ALG-2 interacting protein X
  KO
K12200  programmed cell death 6-interacting protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03250  Viral life cycle - HIV-1
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    4330097
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4330097
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4330097
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4330097
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT associated proteins
    4330097
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4330097
SSDB
Motif
Pfam: BRO1
Other DBs
NCBI-GeneID: 4330097
NCBI-ProteinID: XP_015627620
UniProt: Q6H5V3 Q6H7F8
LinkDB
Position
2:complement(25592004..25595230)
AA seq 353 aa
MSRPPSPMLSVPEKKTAATELFRDRHFFNSAFFTDLREARASLSAPSSQATTQDAASRRA
LLLRYHRLLASARDDPCDFDDDLAFTWHDAFRPHLRRTAASLRFEKAAVVFNVGAASSRI
AAAVDRAAVGGVKAACGEFQRAAGAFRAAGEMMEGEEEDTEDTVDMGPEASAMLERLMLA
QAQECCFERALAAGTSSAACSKVAKQAALYYEEAYASLVIPPLQNHFERSWVAHILLKAA
LFNAEASYHYAIELHEKTEIGEEIARLQFGINAIVDAKKAVRGAPGSLYDAASRLEQDMN
QNLERALNENNRIYLLRVPAAKLLAPLPAASLVRSASLSEILDVKTETGNQSS
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgtcgcggccgccgtcgccgatgctctccgtcccggagaagaagacggccgccaccgag
ctcttccgggaccgccacttcttcaactcggccttcttcaccgacctccgggaggcacgc
gcttccctctccgctccgagctcccaggcgacgacccaggacgccgcctcccgccgcgcg
ctcctactccggtaccaccgcctcctcgcctccgcgcgcgacgacccctgcgacttcgac
gacgacctcgccttcacctggcacgacgccttcaggccccacctcaggcgcaccgcggcg
tccctccgcttcgagaaggccgccgtcgtgttcaacgtcggcgccgcctcgtcgaggatc
gcggcggccgtcgaccgggcggcggtgggcggggtcaaggctgcgtgcggggagttccag
cgcgccgcgggggcgttcagagcggcgggggagatgatggagggggaggaggaggacacg
gaggacacggtggatatgggccccgaggcctccgcgatgctggagcggctcatgctcgcg
caggcgcaggagtgctgcttcgagcgcgctctcgccgcggggacgtcgtcagcggcttgc
tccaaggtcgccaagcaggctgccttgtattatgaagaagcttatgcttcactggttatc
cctccactacaaaaccactttgagagatcttgggtagcacacatcctgttaaaggctgct
ctattcaatgcagaagctagctatcactatgctattgaactgcatgagaaaacagaaatc
ggtgaagagatagctcgattacagtttggaattaatgcaattgtcgatgcaaagaaagct
gtccgtggagccccaggatccctttatgatgctgcctccagactcgaacaagatatgaac
cagaacttggagagagcactgaatgagaacaaccgcatctatcttctgcgagtcccagca
gccaaactactagctcctctgccagcagcttcacttgtccggtctgcttccctgagtgag
atcttagatgtgaagacagaaaccggtaatcaatcatcgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348999
Entry
4348999           CDS       T01015                                 
Name
(RefSeq) ALG-2 interacting protein X
  KO
K12200  programmed cell death 6-interacting protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03250  Viral life cycle - HIV-1
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    4348999
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4348999
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4348999
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4348999
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT associated proteins
    4348999
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4348999
SSDB
Motif
Pfam: BRO1 ALIX_LYPXL_bnd zf-C4H2 Pheromone
Other DBs
NCBI-GeneID: 4348999
NCBI-ProteinID: XP_015613589
UniProt: Q8LNU2 A0A0P0XVQ5
LinkDB
Position
10:complement(18837745..18843228)
AA seq 883 aa
MSSAANVMLAIHEKRTTPTDLYRPLRLYIASAYSEREAAAADDDLAAVRDLRADVEQPSL
PDPSSLERRRDALLAYARALSLVEPRFPISSDRAHVHSLAFTWHDAFKTGKKASVASIHL
EKAAVLFNLAAVYSQIALAADRATDVGIRTACGSFQSAAGAFAWMRESGVAAKAVAAGAT
TVDVTPECAAMLEKLMLAQAQECFFEKVIAGGKPPALCSKVARQVGIFYEEAYAALSAAP
LSQHFDKTWVSHVQLKAAQFYADACYRCSLDLHEKEEIAQEIARLKIGISALADAKKVAR
GVAAPLLDSVNKLESNMKTNLERAMKENDRVYLMRVPDASSLGALPAASLVKPTSLAEVL
DASKERLFSSLVPDGSMKALSKYTEMVDNIIRTQAEKLQQASEITRVRLKEMDLPDSILS
LEGNITLPLDLKEDVEAVQISGGPAGLEAELQQLRDLSRVNQELLVQTEEMLQKEANEDA
QFRTQFGSRWTRPQSSTLTKNIQDRLNLFASNLKTAGDSDSQIERGLKESYPLISILDRR
PIESALPSISRPIMSLDGNEDAIVGALKQSLRQLESLGAQRAGLEDMLKEMKRKDDILPK
LMAGVGSHDDLFKKEISKYDPVCAEIADNIVAQEQLLLQIQAQNEQFAAVFNLEDYKVAR
ERCYKQIAAAVAKYRDIKKNINEGLNFYVTLQEAIGKIKQQCSDFIMTRNIQCREMIEDV
QKKLAGFSFSSSSSQASMQRNTSVPPDQNSPSPPPPSSHAPHAQGPYGVPPGGDSRPGYS
QPEQRPAYSQPYPPYGAPPQQPPYGAPSQQPPYGAPHPGHYQQPPHQQPPNHDYGQQAYP
GGWRGQYYNPHQPQPQPQPPYPQPPYNAQGSYPPHQSSYYRPQ
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgtcgtcggcggcgaacgtgatgctggcgatccacgagaagaggaccacccccaccgac
ctctaccgcccgctccgcctctacatcgcctccgcctactcggagcgggaggcggccgcg
gccgacgacgacctcgccgcggtgcgcgacctgcgcgccgacgtcgagcagccgtcgctc
ccggacccgtcctccctcgagcgaaggcgggacgcgctcctcgcctacgcgcgcgccctg
tccctcgtcgagccccgcttccccatctcctccgaccgcgcccacgtccactccctcgcc
ttcacctggcacgacgccttcaagaccggcaagaaggccagcgtcgcctccatccacctc
gagaaggccgccgtgctcttcaacctcgccgccgtctactcccagatcgcgctcgccgcg
gaccgggccaccgacgtcgggatcaggaccgcgtgcggctcgttccagagcgcggcgggg
gcgttcgcgtggatgagggagagcggcgtcgccgccaaggccgtcgcggccggggccacc
accgtcgacgtcacccccgagtgcgccgccatgctggagaagctcatgctcgcgcaggcg
caggagtgcttcttcgagaaggtgatagccggtgggaagccgcccgcgctgtgctccaag
gttgcccggcaggtgggcatattctatgaagaagcctatgcagctcttagcgcagctcct
ctcagtcagcactttgataagacatgggtttctcatgtccagctgaaggcagctcagttc
tatgctgatgcttgctataggtgttctttggatcttcacgagaaagaagaaattgcacag
gaaattgcacgtctgaagattggaattagcgctttggcagatgccaagaaggtggccagg
ggagttgctgccccacttcttgattctgttaataagctggagagtaatatgaagaccaac
ttggagagggctatgaaagagaatgaccgtgtttatctgatgagggttccggatgctagt
tctcttggcgcgctccctgcagcatcacttgtaaagcctacatctttggctgaagttcta
gatgctagcaaagagaggcttttttcatcacttgtgcctgatggaagcatgaaagcactt
tccaagtacactgagatggtagataacatcatcaggactcaagcggagaaattacagcaa
gctagtgagatcactagagttaggttgaaggaaatggacttgcccgattccattctttca
ttagaaggtaatatcaccttacctttagatttgaaggaagacgttgaggctgttcagata
agcggaggccctgctggattggaagcggagttgcagcagcttagggatttaagcagagtc
aatcaggaattacttgttcagaccgaagagatgctgcagaaggaggcgaatgaagatgct
cagtttcggacgcaattcgggagtcgttggactagacctcaatctagcaccctaacaaaa
aacattcaagaccgattgaatctgtttgcttctaatcttaagacagctggtgatagtgat
tctcagattgagcgaggtttgaaggagagctatccattgatatctattcttgacagaaga
ccgatagagtctgcactaccgagtatttctaggcctattatgtccttggatgggaatgag
gatgctattgttggagcccttaaacaaagcttgaggcaactagaatctctaggagcacag
agagcaggtcttgaagacatgcttaaagaaatgaagagaaaggatgacatactccctaaa
ttgatggccggtgttggatcacacgatgatctttttaagaaggagatttcaaagtatgat
cctgtctgtgctgagatagctgataacattgtggcgcaagaacaactgctgctacaaata
caggcacaaaatgaacagtttgctgcggtgttcaacctagaggattacaaagttgctcgt
gagagatgttacaagcaaattgctgcggctgttgctaaataccgagatattaagaagaac
attaatgaaggcctcaatttttatgtgacattacaggaagcaattggcaaaataaagcag
cagtgcagtgacttcataatgacccgaaacattcaatgccgtgaaatgatcgaagatgtg
cagaagaagctagcaggtttcagcttctcatcttcttccagccaagcaagcatgcagagg
aatacttctgtgccaccagatcagaacagtccatcaccaccaccaccgtcgtcgcatgct
ccccatgctcagggcccatatggtgttccacccggaggcgattcaagacccgggtactct
cagcccgagcaaagacctgcttactcacagccatacccgccctatggcgcgccaccgcaa
cagcctccatatggtgcgccgtcgcaacagccaccttatggcgcgccccaccctggtcac
taccaacagccaccacaccagcaacctcccaaccatgactatggccaacaagcatatcct
ggaggatggcgcgggcagtactacaatccacatcagccacagccgcagccacagccgcca
tatcctcagccaccgtacaatgcccagggttcttaccctcctcaccagagcagctactac
aggcctcaatga

DBGET integrated database retrieval system