KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330186
Entry
4330186           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor TFIID subunit 4b
  KO
K03129  transcription initiation factor TFIID subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4330186
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4330186
   03036 Chromosome and associated proteins [BR:osa03036]
    4330186
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     4330186
   Coactivators
    SAGA/TFTC/STAGA complex
     4330186
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     4330186
SSDB
Motif
Pfam: TAF4 RST
Other DBs
NCBI-GeneID: 4330186
NCBI-ProteinID: XP_015626016
UniProt: Q6H7I0 A0A0P0VMB8
LinkDB
Position
2:complement(26396519..26403266)
AA seq 728 aa
MSTQLTEHDHQPEQEPPHSENHLKQAEPNSFQFAEKETGYAGLQNFTGPKVDVGQTSGEQ
QHVKQMVGQQAPPGAQDARKRGYQPSIPFNMLIPILQAHLDRDKDMQLQTVWAKLRRNEV
HKDDFLRVIRNIVGDQMLKQAAHKVFAQMQAQAQRSGQANANQQANANQYSLQSQVSSSG
SAQLHDQQVHVSTTPNQGQKNQALSSSQTFVQSGTQVQSSMTAHDNSIQRPDAKGMHVTP
NRPPVMNSAISAQTMNKQQQPTQVQQASQQIYGTTNRPDQPYTRPIGGSTPLSSLSSESE
IRPSSHPAKMEILPSHPMTQQNAAAQQMQQNKDVKTNASNPRSNAKQDSGTGKGRAVGTG
GSSTKSQGKQGPPNFSTPPAAKSNKKTAGQKKSLETSGSTPPPPSKKQKTSGTFQEQSFD
QLNDVTAVSGVNLREEEEQLLSAPKEESWASEEARKIAQEEDGKLFLQKGPLLKKLAAIV
PKCNLKSIGGDVEHCLSMCVEERLRRFISTLIRVSKQRIDTEKSGHQLVITSDVGRQILR
MNQKAKEEWDKKQAEETDKNKKQNEVDGGGTVELDKEKEETRSKNAKPNKEEDDKMRTTA
ANVAARQAVGGSDMLSKWQLMAEQARQKREGLDLAASSQRGTASRSHMAGKGPTDHHEAS
KRTHSAAFGTGGMNRQGRGPFAASHPKGPQRTISMKDVICVLEREPQMTKSRLIYRLYER
LPGDSTRD
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgtctacccaattaacggaacacgatcaccagccagaacaagaaccaccacattctgaa
aaccatctgaaacaggcagagccaaacagcttccagttcgctgaaaaggaaacaggctat
gctggtctacagaatttcacaggccccaaggtggatgtgggtcagacttcaggagagcag
cagcatgtaaaacagatggtcggtcagcaagcaccacctggtgcacaggacgcaaggaag
cggggataccaaccgtctataccatttaatatgttgattccaatcctacaggctcatctt
gacagagacaaggatatgcagcttcaaactgtgtgggcaaaacttaggcgtaatgaagtt
cataaagatgatttcttgagagttatcaggaacatcgttggagatcaaatgctaaagcaa
gcagcccataaagtttttgcacagatgcaagcccaggcacagagaagtggccaggcaaat
gcaaatcagcaggctaatgcaaatcagtattctttacaatcccaagtatcttccagcggt
tcagctcaattacatgatcagcaagttcacgtgtccaccacacctaatcagggccaaaaa
aaccaagcattgtcttcatcccaaacctttgtgcaatctggcactcaggtgcagagcagt
atgactgctcatgataattccatccaacggccagatgcaaagggaatgcatgttacgccg
aaccgacctcctgttatgaactcagcaatttctgcacaaacaatgaacaaacagcagcaa
cccacacaagtccagcaagcctcacagcaaatatatggaacaactaatcgccctgaccag
ccatacactaggccaatcggtggttcaacacctcttagctcactgagttcagaatcagaa
ataaggccttcctctcatcctgcaaaaatggagattcttccttctcatccaatgacacaa
caaaatgcagctgcgcagcaaatgcaacagaacaaggatgtgaagactaatgcttctaat
ccaaggagtaatgcaaagcaagattcggggacaggtaagggtcgtgcagttggcactgga
ggttcttcaacgaaatcgcaagggaagcagggcccccctaacttttccacacctcccgct
gcaaagagtaacaagaaaactgctgggcagaagaagtcattggaaacatcaggctctaca
ccaccccctcctagcaaaaagcagaagacttctggaaccttccaagaacaaagcttcgat
caactaaatgatgtcacggctgttagtggtgttaatcttagggaagaagaagaacagcta
ctctctgccccaaaggaagagagctgggcctcagaagaagcaaggaaaattgcacaggaa
gaagatggcaagctttttctgcagaaaggcccacttctgaagaaactagcagcaatcgtt
cctaaatgcaatttgaagagcattggtggtgatgttgagcattgtttatcaatgtgcgtg
gaggagcgattgcgaagatttatcagtactctcataagagtttcaaagcagagaattgac
acagaaaagtctggccatcaactagttataacatcagatgttggccggcaaattttgcgg
atgaaccagaaagctaaggaagaatgggataaaaaacaagcagaggaaacagacaagaac
aagaaacaaaatgaggttgacggcggtggcactgtggaattagacaaggaaaaggaggaa
actcgttcaaagaatgcaaagcccaacaaagaagaagatgacaagatgagaacaacagct
gcaaatgttgccgcccgacaggctgttggaggaagtgatatgctgtccaaatggcaactg
atggctgaacaagctagacagaaacgcgaaggccttgatctggctgcttcttcacagcgc
gggacagcttccaggtcgcatatggctgggaaaggtcccacagatcaccacgaagcttcg
aagaggacccattctgcagcgtttggaactggaggcatgaacaggcaaggcaggggtcca
tttgcagcgtctcatccaaaaggaccacaaagaactatttctatgaaggatgtaatatgt
gtcctcgagagggaacctcagatgacaaaatcgcggctgatatatcggctctatgagcgg
ttgcctggagattccaccagagattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333214
Entry
4333214           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor TFIID subunit 4b isoform X1
  KO
K03129  transcription initiation factor TFIID subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4333214
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4333214
   03036 Chromosome and associated proteins [BR:osa03036]
    4333214
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     4333214
   Coactivators
    SAGA/TFTC/STAGA complex
     4333214
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     4333214
SSDB
Motif
Pfam: TAF4 RST DUF4513
Other DBs
NCBI-GeneID: 4333214
NCBI-ProteinID: XP_015631228
UniProt: Q10IZ0 A0A8J8XZG1
LinkDB
Position
3:complement(18638515..18647660)
AA seq 819 aa
MDPLIKLLDDDVDETMHSGADVEAFTAALNREVEGSGGASTSAAASSSQPLDHGAGLVPQ
ESNSMFTHNHEQWQGSVKNEIGNQENQQQEQKHLHHSNEQPSRPELVSGGADNKQDQPKV
KQEPGNSSQQSNSGQKQPLQQMRSQQTPSTNQTNSAPTVGKPPVVTFHMLIPILRRHLDK
DKDMQVQSIFTKLRKNEVSKEHFLKVVRTIVGDKLLKQAAAQYQAQAAHGQRNPQTNPSN
YSLLSQVSNQQNVPSGSTSGVEHKSYPSAHSIPANQASDSPRPPFFRPSLSGQMQSNMGY
PSSESNLQKVNESSNMSDVKGGHMLSHPHNIQSAPGQATQHPQTSLPVLGSNNIHARPLP
RPVGGPIVPLRPQMADSSQRGQLVQGAVTSVTGSMAARPTLQTNISPWQQVNKEQKTKSF
PPTEHTNKGVGVPENQPSTSGTSKSFNTTNSSQPHRSHGTQAEPNMQIQPATQTPPPAAA
SKTPQKKASAGQKKPLDALGSSPPPSSKKQKTSGGYHDQSIDQLNDVTAVSGVNLREEEE
QLFSAPKEESRVSEAARMVVQLEEEKLILQKGPLKKKLAEIMRKCNLKSIGSDVERCLSM
CVEERLRGFISNTIRLSKQRVDLEKSRHRIYPLSSDVRSHILRVNREAREQWDKKLAEDA
ERIRKQSDGDDNAVVDSEKDKNESRSTSKHAKTYKAEDDKTRTTAANAAARVAAGGDDML
SRWQFMAEKKKSKCDGDGSSGSMPGNMLPRTSSPKPGKGSREQQEIEKTGGVRRSSHVKV
TRSITVKDVIAALEREPQMLKSSLLFQLYGRSPAESSAK
NT seq 2460 nt   +upstreamnt  +downstreamnt
atggatcccctcataaagctccttgacgacgacgtggacgagaccatgcactcgggcgcc
gacgtcgaggccttcacggcggcgctcaaccgcgaggtggagggcagcggcggcgcgagc
accagcgccgcggcctcctcctcccagccgctggatcacggcgccggtcttgtgcctcag
gagagcaattcaatgttcacccacaatcatgaacagtggcagggttcagtaaagaatgaa
attggaaaccaggagaaccaacaacaggaacagaaacatttgcatcattcaaatgagcag
ccatctaggcctgaactggtatctgggggtgctgataataaacaagaccagccaaaggtt
aagcaagagccaggaaacagttctcaacaaagtaattctggtcagaagcagcctttgcaa
cagatgaggagtcaacaaacaccaagcacaaatcaaactaatagtgctcctacggtgggg
aaacctcctgttgttacatttcatatgttaataccaattttgagacggcaccttgacaaa
gacaaggatatgcaagttcagtccatttttacaaagttgcggaaaaatgaagttagcaag
gaacactttctcaaagttgtaaggactattgttggcgataagttgctcaaacaagctgct
gcacaatatcaagctcaggctgctcatgggcaacggaatccacagacaaatccaagcaac
tattctttgttaagtcaagtttccaatcagcagaatgttcccagtggttctacgtcagga
gttgagcacaaatcatatccgtcagctcattccattcctgcaaaccaagctagtgacagc
ccaagaccaccttttttccgaccttctttgtcaggccaaatgcaaagtaacatgggctat
ccatcttcagaaagcaatttgcaaaaggttaatgaatctagtaacatgtcagatgtgaaa
ggggggcatatgctcagccatccacacaatatacaatcagccccagggcaagcaacacag
catccacaaacatctttacctgtgcttgggtcaaataatattcatgctcgtccattgcca
cgaccagttggaggtccaattgtaccacttagaccacaaatggcagattccagtcaaaga
ggacaattagtccagggagctgttacctcagtgactgggagcatggcagcacgaccaacg
ttgcaaactaatatatctccatggcaacaagtaaacaaagagcagaaaactaaatctttc
cctccaacagaacacacaaataagggtgttggtgttcctgaaaaccaaccatcaacatca
ggtacttctaaatctttcaacacaacaaactcaagtcagcctcatcgatctcatggcact
caagcagaaccaaacatgcagatccaacctgctacacaaacacctccccctgcagcagct
tctaaaacacctcaaaagaaggcatctgctggacagaagaaacctttggacgctttaggc
tcatcccctccaccatctagcaaaaagcagaagacatccggaggttatcatgatcaaagt
attgaccagctgaatgatgttactgcagttagtggtgttaatctgagggaagaagaggag
caacttttctctgctccaaaggaggagagtcgagtttcagaagctgctcggatggtcgta
caacttgaagaagaaaaactcatcctacaaaagggtcctctgaaaaaaaaattagcagag
atcatgaggaaatgcaatttgaagagcataggcagtgacgtggagcgatgtctatcgatg
tgtgttgaagagcggttacgaggattcataagcaatacaataagactttcaaaacagagg
gttgatcttgaaaaatcaagacatcgaatttatcctttgtcttcagatgttcgtagtcac
attttgagggtgaacagagaagctagagaacagtgggacaaaaagctggccgaagatgct
gaaagaatcaggaaacagagtgatggagatgacaatgctgtggttgattcagagaaggac
aagaatgagagtcgtagcacatcaaagcatgctaagacctataaggcggaagatgataaa
acgagaacaacagctgcaaatgctgctgcacgagttgcagcaggcggagatgacatgctt
tcaaggtggcagttcatggctgaaaaaaagaagagcaaatgtgatggtgatggttcttct
ggttccatgccaggcaacatgttgcctcgtacgtcttcaccgaaacctggaaaaggttca
agagaacaacaggaaattgaaaagacaggtggtgttagaagatcatcacacgtaaaagtg
acccggagcattacggtgaaggatgtgatcgcagcacttgagagggaacctcagatgttg
aaatcctctttgctgttccagctatatgggagatcaccagcagaatcatctgcgaaatag

DBGET integrated database retrieval system