KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330199
Entry
4330199           CDS       T01015                                 
Name
(RefSeq) anaphase-promoting complex subunit 8
  KO
K03355  anaphase-promoting complex subunit 8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4330199
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4330199
   03036 Chromosome and associated proteins [BR:osa03036]
    4330199
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     4330199
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    4330199
SSDB
Motif
Pfam: ANAPC8 TPR_1 TPR_8 TPR_2 TPR_14 TPR_11 TPR_7 TPR_19 TPR_12 TPR_16 TPR_17 ANAPC3 ChAPs TPR_9 PPTA
Other DBs
NCBI-GeneID: 4330199
NCBI-ProteinID: XP_015622608
UniProt: A0A0P0VMI7
LinkDB
Position
2:26511083..26515540
AA seq 597 aa
MASSNETYRVELRAAARQLGERGLYSAAKWAAELLVGIEPDATPAPSSVMDTPSSSGSAA
SGGRLLHLHRSGGSSFRRRLRPGAAEAGTPLGGVSYVSTPIPDDDAFDVGGDRYLLAKTY
FDCREYRRAAHVLRGQTGRKAVFLRCYALYTAGEKRKEEETVELEGSLGKSNAVNQELVA
LERELATHRRTGAIDSFCLYLYGIVLRDKGSEALARTVLVESVNSYPWNWSAWLELQSLC
TSSDILNNLNIKNHWMKDFFLASAHLELKMHEEALKRYERLMGVFRCSDYIQAQIATVQY
SMRDLDEADMIFEELLRTDPFRVDSMDVYSNLLYAKESSTALSFLAHRVFLTDKYRPESC
CIIANYYSLKGQHEKSVLYFQRALKLNRKYLSAWTLMGHEFVELKNTPAAIDAYRRAVDI
NPRDYRAWYGLGQIYEMMGMPFYAVYYFRKSSYLQPNDARLWNAMAQCYESDQLQMIEEA
IKCYERSANNNDTEGIALHQLAKLHGMLGQSEEAAFYYKKDLERMEVEERQGQNFVEALL
FLAKHCKSIGRFEEAEHYCTRLLDYTGPERETAKSILQGLKRAQSVLPLMDIDHFAM
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggcttcctccaacgaaacctaccgcgtcgagctccgagccgccgcccgccagctcggc
gagcgcggcctctactccgccgccaaatgggcggccgagctgctcgtcggaatcgagccc
gacgcgacgccggccccgtcgtcggtgatggacaccccttcctcgtcgggctccgccgca
tccgggggccgcctcctgcacctccaccgcagcggcgggtccagcttccgccgccgcctc
cgcccgggcgcggccgaggccgggacgccgctcggcggcgtctcgtacgtcagcacgccc
atccccgacgacgacgcgttcgacgtggggggtgataggtacctgctcgccaagacctac
ttcgactgccgcgagtaccgccgcgccgcgcacgtcctgcgcggccagaccggccgcaag
gccgtgttccttcggtgctatgccctgtacacggctggagagaaacggaaagaggaagaa
acagtcgagcttgagggatctctgggcaaaagcaatgctgttaatcaggaactagttgca
ttggagagagagctcgcaacacatcggagaactggtgctattgattcattttgtttgtac
ttgtatggcattgttctacgtgataaaggcagtgaagctctagctagaacagttctggtg
gaatctgtcaacagctacccttggaactggagtgcttggttagagttacaatctctctgc
actagcagtgacattttgaacaacttaaatatcaagaatcactggatgaaagatttcttc
cttgctagtgcacatctcgaattaaaaatgcatgaagaagctttgaaaagatatgagcgc
ttaatgggggttttccgttgcagtgactacattcaggctcaaatagctaccgtgcagtat
agtatgagagacctggatgaagctgacatgatttttgaagaactccttaggactgatcct
ttccgtgtggattctatggacgtttactcaaatttattgtatgcaaaagaaagctcgact
gctttgagtttccttgctcacagagtatttttgacagataaatatcgcccagaatcttgc
tgcataattgcaaattactacagtttgaaggggcagcatgaaaaatcagttctgtacttt
caaagagcgctgaagcttaatcgaaagtatctttcagcttggactcttatgggacatgag
tttgttgagctaaaaaatacacctgctgcgattgatgcctacaggagagctgttgatata
aatcccagagattaccgtgcttggtatggtcttggtcagatctatgagatgatgggaatg
ccgttttatgcagtttattacttccgtaagtcatcatacctacaacctaatgatgcccgg
ctttggaatgctatggctcagtgctatgaaagtgatcaactccagatgattgaagaagcc
atcaagtgctatgagagatctgcaaataataatgacaccgaaggaatagcacttcatcag
ctagcaaagttacatggtatgcttggacaatcagaggaggcagcattttactacaagaag
gatctagagagaatggaagttgaggaaaggcagggccagaattttgttgaagctctgctt
ttccttgctaagcattgcaagagcataggcaggtttgaggaggcagagcactattgcaca
aggctcttggattacaccggtccggaaagggagactgcaaaaagtattttgcaagggcta
aaaagagcacaatcggtacttccgttgatggatatcgaccattttgcaatgtaa

DBGET integrated database retrieval system