KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330235
Entry
4330235           CDS       T01015                                 
Name
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00480  Glutathione metabolism
osa00590  Arachidonic acid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    4330235
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4330235
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     4330235
SSDB
Motif
Pfam: GSHPx AhpC-TSA Redoxin LppA
Other DBs
NCBI-GeneID: 4330235
NCBI-ProteinID: XP_015622746
UniProt: B9F1I4 Q6ESJ0
LinkDB
Position
2:26929720..26932345
AA seq 238 aa
MPSRTAPFISRLRLLRTAAALSPFSSSAPPRHSPRILRAIPVGAPHPPRVSAAVSPLVRP
VAAGFALFSMATAASSAASVHDFTVKDASGKDVDLSTFKGKVLLIVNVASQCGLTNSNYT
ELSQLYEKYKDQGFEILAFPCNQFGGQEPGTNEEIVQFACTRFKAEYPIFDKVDVNGDNT
APIYKFLKSSKGGLFGDNIKWNFSKFLVDKEGRVVERYAPTTSPLSMEKDIKKLLGSS
NT seq 717 nt   +upstreamnt  +downstreamnt
atgccgtctcgcaccgccccgttcatctctcgcctccggctcctccgaaccgccgccgcc
ctctccccgttctcgtcctccgcgccgccgcggcacagcccccgcatcctccgcgctatc
cctgtcggtgcgcctcacccgccgcgcgtctccgcagccgtctcgccgctggtccgtccg
gtcgccgccgggttcgcgctgttcagcatggccaccgccgcctcctccgccgcatccgtc
cacgacttcaccgtcaaggatgcaagtggcaaagatgtggacctgagcaccttcaagggg
aaagtcctccttatcgtcaatgttgcatctcagtgtggcttgaccaattccaactacacg
gagctgagccagttgtatgagaagtacaaggaccagggttttgagatccttgctttccca
tgcaaccagtttggtggacaggaacctggcactaatgaggagattgtccaatttgcttgc
acccgcttcaaggccgagtatccaatttttgataaggttgatgttaatggtgacaacact
gcacccatctacaagtttctgaagtccagcaaaggtggtcttttcggtgacaatatcaaa
tggaacttctccaagttcttggtcgacaaagaggggcgtgttgtggagcgctatgcgcca
actacttctccactcagcatggagaaggacatcaagaagctgcttggaagttcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332876
Entry
4332876           CDS       T01015                                 
Name
(RefSeq) probable glutathione peroxidase 4
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00480  Glutathione metabolism
osa00590  Arachidonic acid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    4332876
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4332876
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     4332876
SSDB
Motif
Pfam: GSHPx AhpC-TSA Redoxin Thioredoxin_8
Other DBs
NCBI-GeneID: 4332876
NCBI-ProteinID: XP_015632791
UniProt: Q10L56 A0A8J8YSU3 Q9FEV2
LinkDB
Position
3:13879042..13882331
AA seq 169 aa
MGAAESVPETSIHEFTVKDCNGKEVSLEMYKGKVLIVVNVASKCGFTETNYTQLTELYQK
HRDKDFEILAFPCNQFLRQEPGSDQQIKDFACTRFKAEYPVFQKVRVNGPDAAPLYKFLK
ASKPGLFGSRIKWNFTKFLIDKNGKVINRYSTATSPLSFEKDILKALED
NT seq 510 nt   +upstreamnt  +downstreamnt
atgggggcggcggaatccgtgccggagacctccatacacgaattcaccgtcaaggattgc
aacggcaaggaggtgagcctggagatgtacaaggggaaggtgctaatcgtcgtcaacgtc
gcctccaaatgtgggttcacggagaccaactacacgcagctgacggagctctatcagaaa
cacagggacaaagattttgagattctagcatttccctgcaatcagttcttgcgacaagag
ccaggatctgaccagcaaataaaggattttgcttgcacaagatttaaagctgaatatccc
gtttttcagaaggtgcgtgtaaatggtcctgatgctgcaccactttacaaatttttgaaa
gctagcaagcctggcttgtttggatctagaatcaagtggaactttaccaaatttcttatt
gataagaatggcaaagtcattaacagatactcgactgcgaccagtcccttgtcttttgag
aaagacatcctgaaggcgctcgaggattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336627
Entry
4336627           CDS       T01015                                 
Name
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00480  Glutathione metabolism
osa00590  Arachidonic acid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    4336627
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4336627
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     4336627
SSDB
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 4336627
NCBI-ProteinID: XP_015635940
UniProt: B9FGI6 Q0JB49
LinkDB
Position
4:27838589..27840730
AA seq 168 aa
MAAAPSATSVHDFTVKDASGKDVNLSTYKGKVLLIVNVASQCGLTNSNYTELSQLYEKYK
VQGFEILAFPCNQFGGQEPGSNEEIVQFACTRFKAEYPIFDKVDVNGNNAAPLYKYLKSN
KGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGSS
NT seq 507 nt   +upstreamnt  +downstreamnt
atggccgccgcgccgtccgccacctccgtccacgacttcaccgtcaaggatgcaagcgga
aaagacgtgaacctgagcacctacaaggggaaggttctcctcatcgttaacgtcgcatcc
caatgtggcttaactaactccaactacactgagctgagccagctgtatgagaagtacaag
gtccaaggctttgagatattggctttcccgtgcaatcagtttggagggcaggaacccggc
tccaatgaggagattgtccagtttgcttgcactcgcttcaaggctgagtatcccattttt
gacaaggttgatgtcaacggtaacaatgctgcacccctgtacaagtatctgaagtctaac
aaaggtgggcttttcggtgatagcatcaagtggaacttctccaaattcttggttgacaag
gagggtcgcgtggtggatcgctatgcgcccaccacctcccctcttagtattgagaaggat
atcaagaagctgcttgggagctcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340341
Entry
4340341           CDS       T01015                                 
Name
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00480  Glutathione metabolism
osa00590  Arachidonic acid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    4340341
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4340341
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     4340341
SSDB
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 4340341
NCBI-ProteinID: XP_015642936
UniProt: B7FAE9
LinkDB
Position
6:4321596..4325114
AA seq 234 aa
MASTTTTTAAAAARFTCLAPATRPASASASAGRFLLPARQWGAATTHGSAAVPVVAAPSR
RWAPGVAYATAATGKSVHDFTVKDIDGKDVALSKFKGRALLIVNVASQCGLTTANYTELS
HLYEKYKTQGFEILAFPCNQFGAQEPGSNPQIKQFACTRFKAEFPIFDKVDVNGPNTAPI
YKFLKSSAGGFLGDLVKWNFEKFLVDKTGKVVERYPPTTSPFQIEKDIQKLLAA
NT seq 705 nt   +upstreamnt  +downstreamnt
atggcgtccaccaccaccaccacggcggcggccgcggcccgcttcacctgcctcgcgccg
gccacgcgccccgcctccgcctccgcctccgcgggccgcttcctcctcccggcgcggcag
tggggggcggcgacgacgcacgggagcgcggcggtgcccgtcgtcgcggcgccgtcgcgg
aggtgggcgccaggggtcgcctacgccaccgccgccaccgggaagagcgtccacgacttc
accgtcaaggacattgatggaaaagatgttgcgcttagcaagttcaagggaagggcgctg
ctaattgttaatgttgcatctcagtgtgggctgacaacagcaaattacacggaactatct
catctttatgagaagtacaagactcaaggatttgagattcttgcatttccttgcaatcag
tttggtgcacaagaacctgggtcaaacccgcagattaagcagtttgcttgtacaaggttt
aaagctgaatttcctatttttgacaaggttgatgtcaacgggcctaacacagcccctatt
tataagtttcttaagtcgagtgctggaggatttttgggtgatcttgtgaaatggaatttt
gagaagttcttggtggacaaaactggaaaagttgttgagagatacccacctacaacttca
ccattccagattgagaaggacatccagaaactccttgcggcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350287
Entry
4350287           CDS       T01015                                 
Name
(RefSeq) probable glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00480  Glutathione metabolism
osa00590  Arachidonic acid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    4350287
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4350287
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     4350287
SSDB
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 4350287
NCBI-ProteinID: XP_015615485
UniProt: A3CAI7 Q53MS9
LinkDB
Position
11:complement(10230354..10232974)
AA seq 212 aa
MAATTTSSSSGGGNRIWTSSLAVLALAVALVSLLSLRAPPPAAPSMADDLPTSVHDISVK
DIKGNDVKLSEYEGKVLLIVNVASKCGLTNSNYKELNVLYEKYKEKGLEILAFPCNQFAG
QEPGSNEEIEQTVCTRFKAEFPIFDKIDVNGKEAAPLYKFLKSQKGGFLGDGIKWNFTKF
LVGKDGKVVERYAPTTSPLKIENDIQKLLGTS
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcggctacaactacaagtagcagcagcggcggcggcaaccggatctggacctcctca
ctcgccgtcctcgcgctcgccgtcgccctcgtctccctcctctccctccgcgcgccgcca
cctgctgcgcccagcatggccgacgacctgcccacctccgtccacgacatctccgtcaag
gatataaagggaaatgatgtgaagctgagcgagtatgaggggaaggttcttcttattgtt
aatgtggcctcaaaatgtggcttaacaaattccaattacaaggagttgaatgtcttgtac
gagaaatacaaagaaaaaggccttgagatactcgcatttccgtgcaaccaatttgctggt
caagagcctggcagcaatgaagagattgagcaaacagtttgtaccagattcaaagcagaa
tttcctatttttgacaagattgatgttaacgggaaggaggccgcaccgctatacaagttc
ttgaaatcacagaaaggtggattccttggtgatggcatcaaatggaacttcacgaagttt
ctcgttggtaaagatggcaaggttgttgagcgatatgccccgacgacttctccattaaag
attgagaatgatatccagaagctacttgggacctcgtaa

DBGET integrated database retrieval system