KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330285
Entry
4330285           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase III subunit RPC10
  KO
K03019  DNA-directed RNA polymerase III subunit RPC11
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4330285
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4330285
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     4330285
SSDB
Motif
Pfam: TFIIS_C RNA_POL_M_15KD Nudix_N_2 RNHCP zf-FPG_IleRS tRNA-synt_1g RecR
Other DBs
NCBI-GeneID: 4330285
NCBI-ProteinID: XP_015625442
UniProt: Q6EU09 Q6EU50
LinkDB
Position
2:27369104..27371869
AA seq 110 aa
MEFCPGCGMLLQIQPATGGNRLRFYCPTCPYVCPVKNKIVKKARLVKKEVEPIFSDSDAM
KNAPKTTTTCPRCQNGEAYYRQMQIRSADEPMSTFYKCCREECQFDWRED
NT seq 333 nt   +upstreamnt  +downstreamnt
atggagttctgcccggggtgcgggatgctgctgcagatccagccggccaccggcgggaac
cgcctgcgcttctactgccccacctgcccctacgtctgccccgtcaaaaacaagatcgtg
aagaaggcgagactagtgaagaaggaggtggagcccatcttcagcgacagcgacgccatg
aagaatgcccctaagaccaccactacatgcccaaggtgccaaaatggagaagcatactac
aggcagatgcagattcgatcagctgatgagccaatgtctacattttacaagtgttgcaga
gaagaatgccaatttgattggagggaggactga

DBGET integrated database retrieval system