KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330309
Entry
4330309           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4330309
  KO
K02953  small subunit ribosomal protein S13e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4330309
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4330309
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4330309
SSDB
Motif
Pfam: Ribosomal_S13_N Ribosomal_S15
Other DBs
NCBI-GeneID: 4330309
NCBI-ProteinID: XP_015626944
LinkDB
Position
2:complement(27667885..27671439)
AA seq 336 aa
MAAIASDDEAAEADGCGTIIRLPRNTSLPTCSPPTPPAGNGACGGCASGRTRAPRHCRPS
ELAGRGRPREVRMAREGKEWGAVVVMSPSPPRHGARHGGRVNAASFSGGIVAGVAPTPPR
FLTPATGFQLRSPSGSRYCQEPVVTHDFLNTRCRRRPNYGEVWSLGRFPGLHYGKGISSS
ALPCKRIPPSLLKNAASNVEEMIMKAAKMGQMSSQIGVVLRHQHGIPLVKSIASSKILHI
LKAHGLAPKILEDLYFLIKKAVAIRKHLERNRKDKDSSFRLILVESRIHRLVRYYKRTKK
LPPTLRFKWILFKVGLMLSSLLLTCVLSNLRNGLLC
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggccgcgatagcttcggacgacgaagcggcggaggccgacgggtgcggcaccatcatc
cgccttccccgcaacacctccctccccacttgttctccccccaccccacccgccggcaat
ggggcttgtggcggctgcgcatccggccgcacacgggcaccgcgccactgccgcccgtca
gagctagcggggagaggccggccacgcgaagtaaggatggcgagggaaggcaaggagtgg
ggtgcagtggtggtgatgtcaccgtcgcctccccggcatggagcacggcacggcggccgc
gtcaacgccgcctccttctccggcggcatcgtggccggtgtggcgccaacgccaccgcgc
ttcctcacgccggctactggattccaactccggtcgccctccggcagccgctactgccaa
gagcccgtggtaacgcacgatttcctcaacacgaggtgccgccgccggccaaactacggc
gaggtatggtctctaggaaggtttccaggcctccactacgggaagggtatctcgtcgtcg
gcgctgccgtgcaagaggattcccccgagcttgctcaagaacgccgcctccaatgtggag
gagatgatcatgaaggccgcgaagatgggtcagatgtcgtcgcagattggcgttgtgctc
cgtcaccagcacggaatccccctcgtcaagagcatcgccagtagcaagattcttcacatc
ctcaaggcccacggtcttgcaccgaagatcctggaagacctgtacttcctgatcaagaag
gctgttgctattaggaagcatttggagaggaacaggaaggacaaggactcaagtttcagg
cttattcttgttgagagcaggatccaccgcctcgtccgctactacaagcgcacaaagaag
ctcccacctactttgcgcttcaaatggatactcttcaaagtcggcttgatgttgagttcc
ttgttgctcacatgtgttctgtcaaatttaaggaatggattgttgtgctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343679
Entry
4343679           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S13-2-like
  KO
K02953  small subunit ribosomal protein S13e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4343679
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4343679
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4343679
SSDB
Motif
Pfam: Ribosomal_S13_N Ribosomal_S15 dsDNA_bind
Other DBs
NCBI-GeneID: 4343679
NCBI-ProteinID: XP_015647041
UniProt: Q0D597 Q6ZL24
LinkDB
Position
7:23153166..23154034
AA seq 151 aa
MGRMHSSGKGMSCSVLPYRRAAPAWVKTSASEVEEMIVRVAKKGQLPSQIGAILRDAHAV
PLAQGVTGGKILRVLKSRGLAPEVPEDLYFLIKKAVAMRKHLERNRKDKDTKFRLILVES
RVHRLTRYYRLAKKIPAFFKYDSTTASTLVA
NT seq 456 nt   +upstreamnt  +downstreamnt
atgggccgcatgcacagcagcgggaaggggatgtcctgctcggtgctcccctacaggcgc
gccgctcccgcctgggtcaagacgtccgcgtcggaggtggaggagatgatcgtgcgcgtc
gccaagaagggccagctgccgtcgcagatcggggcgatcctccgcgacgcccacgccgtc
ccgctcgcccagggcgtcaccggcggcaagatcctccgcgtgctcaagtcccgcggcctc
gcgcccgaggtgcccgaggacctctacttcctcatcaagaaggccgtcgcgatgaggaag
cacctcgagaggaacaggaaggacaaggacaccaagttccgcctcatcctcgtcgagagc
agggtgcaccgcctcacccgctactaccgcctcgccaagaagatccccgccttcttcaag
tacgactccaccaccgcgagcactctcgtggcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344523
Entry
4344523           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S13-1
  KO
K02953  small subunit ribosomal protein S13e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4344523
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4344523
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4344523
SSDB
Motif
Pfam: Ribosomal_S13_N Ribosomal_S15 HK97-gp10_like
Other DBs
NCBI-GeneID: 4344523
NCBI-ProteinID: XP_015649876
UniProt: Q69UI2
LinkDB
Position
8:complement(956369..958702)
AA seq 151 aa
MGRMHSRGKGISSSAIPYKRTPPSWVKTAAADVEEMIMKAAKKGQMPSQIGVVLRDQHGI
PLVKSVTGSKILRILKAHGLAPEIPEDLYFLIKKAVAIRKHLERNRKDKDSKFRLILVES
RIHRLARYYKRTKKLPPTWKYESTTASTLVA
NT seq 456 nt   +upstreamnt  +downstreamnt
atggggcgtatgcacagccgcgggaagggcatctcgtcgtcggcgattccgtacaagagg
actcccccaagctgggtcaagaccgccgccgccgatgtggaggagatgatcatgaaggcc
gcgaagaagggccagatgccgtcgcagatcggcgtggtgctccgtgaccagcacggaatc
cccctcgtcaagagcgtcaccggcagcaagatcctccgcatcctcaaggcccatggtctt
gcgccggagatcccggaggacctgtacttcctgatcaagaaggctgttgctattaggaag
catttggagaggaacaggaaggacaaggactccaagtttaggctcatccttgttgagagc
aggatccaccgcctcgctcgctactacaagcgcaccaagaagctcccgcccacctggaag
tatgagtcgaccacagccagcactctggtggcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344524
Entry
4344524           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S13-2
  KO
K02953  small subunit ribosomal protein S13e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4344524
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4344524
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4344524
SSDB
Motif
Pfam: Ribosomal_S13_N Ribosomal_S15 HK97-gp10_like
Other DBs
NCBI-GeneID: 4344524
NCBI-ProteinID: XP_015649875
UniProt: Q69UI1
Structure
LinkDB
Position
8:complement(962673..964577)
AA seq 151 aa
MGRMHSRGKGISSSALPYKRTPPSWLKTAASDVEEMIMKAAKKGQMPSQIGVVLRDQHGI
PLVKSVTGSKILRILKAHGLAPEIPEDLYFLIKKAVAIRKHLERNRKDKDSKFRLILVES
RIHRLARYYKRTKKLPPTWKYESTTASTLVA
NT seq 456 nt   +upstreamnt  +downstreamnt
atggggcgcatgcacagccgcgggaagggtatctcgtcgtcggcgctgccgtacaagagg
actcccccgagctggctcaagaccgccgcctccgatgtggaggagatgatcatgaaggcc
gcgaagaagggtcagatgccgtcgcagatcggcgtggtgctccgtgaccagcacggaatc
cccctcgtcaagagcgtcaccggcagcaagatcctccgcatcctcaaggcccacgggctt
gccccggagatcccggaggacctctacttcttgatcaagaaggctgttgctattaggaag
cacttggagaggaacaggaaggacaaggactccaagttcaggcttattcttgttgagagc
aggatccaccgcctcgcccgctactataagcgcacaaagaagctcccacccacctggaag
tatgagtcaaccacggccagcactctggtggcctaa

DBGET integrated database retrieval system