KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330363
Entry
4330363           CDS       T01015                                 
Name
(RefSeq) probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase
  KO
K03849  alpha-1,3-glucosyltransferase [EC:2.4.1.265]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa01100  Metabolic pathways
Module
osa_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4330363
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4330363
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.265  dolichyl-P-Glc:Glc1Man9GlcNAc2-PP-dolichol alpha-1,3-glucosyltransferase
     4330363
Glycosyltransferases [BR:osa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   4330363
SSDB
Motif
Pfam: Alg6_Alg8 GT87
Other DBs
NCBI-GeneID: 4330363
NCBI-ProteinID: XP_015622955
UniProt: Q6ZGZ7
LinkDB
Position
2:28233590..28237242
AA seq 518 aa
MAAAAATSPARAAAWTFAAATCVKLLLVPTYRSTDFDVHRYWLALTHALPARRWYTDASS
QWTLDYPPFFAYFSRLLALPAPLVDASLVSLPVPDAPPSFAYLLYLRLTVAFSDLLLLLS
SVLLLATDALTRRRRRPFLSLALVLWSPALLAVDHVHFQYNGFLMGLLLLSLHFLEQGRD
LAGGVVFAALLCSKHLFLVAAPVYFVYLFRHYCCGRGVVRGLGRLVLMGAGVAAVFAAAF
VPFLYYGQMQQLFNRLFPFGRGLCHAYWAPNFWVFYILLDKIFAFLLRRLGFNIQIPEAS
FTGGLVGNSSPFAVLPKVTPITTFLLVILAMSPCLMKAFSKPQPRHIIRWVSYATTCGFM
FGWHVHEKASLHFTIPLALIAMDSLEDAKHYFVLSIVSCYSLFPLLFENQEYPIKVMLLL
TYATLMWVGFSSHFAAKSPQEGKKVNESGSVVRKNSFIGWISFSYLLGIVAIELWSQVFH
HYVFGSRFPFLPLIMVSLYCGVGMMYSWMWQLAWIVRH
NT seq 1557 nt   +upstreamnt  +downstreamnt
atggcggccgccgccgccacctccccggcgcgggcggcggcctggaccttcgccgccgcc
acatgcgtcaagctcctgctcgtccccacctaccgctccaccgacttcgacgtgcaccgc
tactggctcgccctcacccacgccctccccgcgcggcggtggtacaccgacgcctcgtcg
cagtggacgctcgactacccgcccttcttcgcctacttctcccgcctcctcgccctcccg
gcgcccctcgtcgacgcctccctcgtctccctccccgtccccgacgcgccgccctccttc
gcctacctcctctacctccgcctcaccgtcgccttctccgacctcctcctcctcctctcc
tccgtcctcctgctggccacggacgcgctcacgcggcggcggcggcggccgttcctctcc
ctcgcgctcgtcctctggtcgccggcgctgctcgccgtggaccacgtacacttccagtac
aacgggttcctgatggggctgctgctgctgtcgctgcacttccttgagcaggggagggat
ctcgccggcggagtcgtttttgctgctctgctgtgctcgaagcacctgttcctagtggcg
gcgccggtctacttcgtgtatcttttccggcattattgctgtggccggggtgtggtgagg
ggattgggaaggttggtgctgatgggggctggtgtggctgctgtgtttgctgctgcattt
gtgcccttcctgtactatgggcagatgcaacagctctttaaccggttgtttccctttggt
cgaggcctgtgccatgcttattgggcgccaaatttttgggtattctacattttacttgac
aagatcttcgcgtttcttcttagaagactaggcttcaacatccagatacctgaagcttca
tttaccggggggcttgttggtaattcgtctccttttgctgttcttcccaaggtcactcca
ataactacatttttattggtcatacttgctatgtctccttgcctcatgaaagcattctct
aaaccccagccaaggcacattattagatgggtgtcatatgcaactacatgtgggtttatg
tttggatggcatgtacatgagaaggcatcactccatttcactattccgcttgccctaatt
gccatggatagcttggaggacgcgaagcattattttgtgttgtcaatagtttcatgttat
tcattgttcccattgttgtttgagaaccaagaatatcctataaaggttatgcttctgttg
acctatgctaccctcatgtgggtaggattttcttcccattttgctgcaaaatctcctcaa
gaagggaagaaagtaaatgaatcaggcagcgtggtcaggaaaaatagcttcattgggtgg
atcagttttagctatcttttaggaattgttgctatagaattatggtctcaagtattccac
cactatgtatttggcagcagatttcctttcctacctctcataatggtgtcactctactgt
ggtgtcggaatgatgtactcatggatgtggcaactcgcatggattgtcaggcactaa

DBGET integrated database retrieval system