KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330379
Entry
4330379           CDS       T01015                                 
Name
(RefSeq) AP-2 complex subunit mu
  KO
K11826  AP-2 complex subunit mu-1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4330379
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4330379
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    4330379
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s
Other DBs
NCBI-GeneID: 4330379
NCBI-ProteinID: XP_015627628
UniProt: A3AAA5 Q6ZGX8
LinkDB
Position
2:28355603..28360590
AA seq 438 aa
MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFLY
MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
DFGYPQNLSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLMYKKNEV
FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKEAQLKSRPA
KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE
LGRTRMEINVKVKSVFGAKMFALGVVVKVPVPKQTAKTSFQTTSGKAKYNASIDSLVWKI
RKFPGQTEATMSAEVELISTMGEKKSWNRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN
TVEWVRYITRAGSYEIRC
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgccggtggcggcgtcggccatctacttcctcaacctccgaggggacgtcctcatcaac
cgcctctaccgcgacgatgtcgggggaaatatggttgatgcattcaggatgcacattatg
caaacaaaagaactgggtacatgccctgttcggcaaataggaggctgttcattcctttac
atgaggattagtaatgtctatattgtgatcgtggttagcagcaatgctaatgttgcttgt
gctttcaagtttgtcgtggaggcagtggctcttttcaagtcatactttggtggtgctttt
gatgaagatgctatcagaaataactttgttttaatctatgagcttcttgatgaaattatg
gacttcggttaccctcaaaacctctcacctgaaatcttaaaattgtatataactcaagaa
ggagttcggtcgccattttcctccaagccttcagataagcctgttccgaatgccactcta
caagttactggtgctgttggttggagaagagagggtcttatgtacaagaagaacgaggtt
ttcttggacattgttgaaagtgtaaatcttcttatgtcttctaaagggagtgttctacga
tgtgatgtgactgggaagattcttatgaagtgcttcctttctggaatgcctgatctgaaa
ttgggattaaatgacaagatcgggcttgaaaaagaagctcaactcaagtccaggcctgca
aagagcggaaagaccattgagcttgatgatgtcacattccaccagtgtgtcaacttgaca
agatttaactcagaaaagacagtcagctttgtgccgccagacggtgaatttgaattgatg
aaatatcgaatcactgagggtgtaaatctcccattccgggttctaccaacgattaaggaa
ttgggccgaacacgcatggagataaatgttaaagttaagagtgtttttggtgctaagatg
tttgcacttggtgttgtcgtcaaagtccctgttccaaaacaaacagcaaagactagtttc
caaaccacatctgggaaagccaaatataatgcttcaattgattccctagtgtggaagatc
aggaagtttcctggacaaactgaggcaaccatgagtgccgaagttgagctgatttctaca
atgggggaaaagaaatcatggaacaggccgccaattcagatggaattccaggttcctatg
tttactgcttctgggttacgagttcggttccttaaggtgtgggagaagagcggttacaac
accgttgagtgggttcgctacatcacaagggctggatcatatgagataaggtgttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331370
Entry
4331370           CDS       T01015                                 
Name
(RefSeq) AP-2 complex subunit alpha-2
  KO
K11824  AP-2 complex subunit alpha
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4331370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4331370
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4331370
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    4331370
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   4331370
SSDB
Motif
Pfam: Adaptin_N Alpha_adaptin_C Alpha_adaptinC2 Cnd1 DUF1241
Other DBs
NCBI-GeneID: 4331370
NCBI-ProteinID: XP_015631820
LinkDB
Position
3:697870..708658
AA seq 1041 aa
MALSGMRGLSVFISDIRNCHNKEQERLRVDKELGNIRTRFKNEKGLSPYEKKKYVWKMLY
IYMLGYDVDFGHMETVSLISAPKYPEKQVGYIVTSCLLNENNDFLRMVINTVRNDIIGRN
ETYQCLALTMVGNIGGKEFSESLAPDVQKLLISSSCRPVVRKKAALCLLRLYRKNPDVVN
IDGWSDRMAQLLDERDLGVLTSVMSLFVSLVSNNAEAYWNCLPKCVRILERMARNQDIPQ
EYTYYGIPSPWLQVKTMRALQYFPTIEDPGARRALFEVLQRILMGTDVVKNVNKNNASHA
VLFEALALVMHLDAEKEMMSQCVALLGKFIAVREPNIRYLGLENMSRMLLVTDVQDIIKR
HQAQIITSLKDPDISIRRRALDLLYGMCDVTNAKEIVEELLQYLNTAEFAMREELSLKAA
ILAEKFAPDLSWYVDVILQLIDKAGDFVSDDIWYRVVQFVTNNEDLQPYAAAKAREYLDK
PALHETMVKVSAYLLGEYGHLLARRPGCSPKELFAIINDKLPTVSTSTVAILLSTYAKIL
MHTQPPDVGLQQQILTIFKKYESYIDVEIQQRAVEYFELSRKGAALADVLAEMPKFPERE
SALLKKAEDAEVDTAEQSAIKLRSQQQTSSAIVIADQPPVNGSVPASNHLTLVKMPSQNI
TEESNVAYEEPPVEIPKENGAPVEVESKVENIPETNIESKVEPPAAHPASQADLLADLLG
PLAIEGPPAAVEQNPVQGLETNQSPVGDLALATLEDQSNSVQPIVNVEEKFHILCSKDSG
VLYEDPHIQIGLKAEWRAHHGRLVLFLGNKNTAPLLSVQALILPPSHLKTELSSVPDTIP
PRAQVQIPLEVVNLRASRDVAVLDFSYTFGTSLVNVKLRLPVVLNKFLQPITLSPEEFFP
QWKALNVQNLKVQEVVKGVKPLPLPEIASLFMSLHLAVAPGLDNNPNNLVACTTFFSETT
RAMLCLVRIETDPQDRTQLRLTVASGDQYLTFELKEYIKEHLIDIPRVQTASPPVPVQPQ
LPPAAVPATYNDPGAMLAGLL
NT seq 3126 nt   +upstreamnt  +downstreamnt
atggcgctctccgggatgcgggggctctccgtcttcatcagcgacatccgcaactgccac
aacaaggagcaggagcgcctccgcgtcgacaaggagctcggcaacatccgcacgcgcttc
aaaaacgagaagggactatcgccttatgagaagaaaaagtacgtatggaaaatgctttac
atatatatgctgggttatgatgttgactttgggcacatggaaactgtttctttgatatct
gctccgaagtatcctgagaaacaggttgggtacattgtgacatcttgcttattgaatgaa
aataatgatttcctacggatggttataaatacagtacgcaatgacataataggacggaat
gagacttatcagtgcttagcattgacaatggtaggtaatattggtgggaaagaattttcc
gagtcactggccccagatgtccagaaacttcttatttctagtagctgccgtcccgtggtc
agaaagaaggcagcactatgccttctgcggctttataggaagaaccctgatgttgtgaat
atcgatggctggtctgatcggatggcacagcttctagatgagcgggatctgggcgtactg
acatctgtcatgagcctttttgtttcactggtatctaataatgctgaagcatattggaat
tgccttccaaaatgtgtaaggatattggagaggatggcaagaaaccaagatatcccacaa
gaatacacttattatggaattccatctccatggcttcaggttaagacaatgagggctctt
cagtacttccctacaattgaagatcctggcgcaagacgagctttatttgaggttttacag
cgcattttaatgggtactgatgttgttaaaaacgtcaacaagaataatgcctcacatgct
gttctctttgaagctcttgctcttgttatgcatcttgatgctgaaaaggagatgatgtcc
cagtgcgtggctcttcttgggaagtttattgcagttcgggaaccaaatattaggtatctt
ggtctggaaaacatgtctaggatgctgttagtaacagatgtacaggatatcattaaaagg
caccaggcccagattattacctctttgaaagatccagatatcagtattagaaggcgggct
cttgatctgttatatggtatgtgtgatgttacgaatgcaaaggaaattgtcgaggagtta
ttgcagtatcttaacacagctgaatttgcaatgcgcgaagagctgtccctgaaggcagct
atccttgctgagaaattcgctccagatctttcatggtatgtcgatgttattctgcagctg
atagacaaagcaggagattttgtaagtgatgatatatggtatcgagtggtacaatttgtc
accaacaatgaagatctgcagccatatgctgcagcaaaggctagagaatacctcgacaag
cctgctttgcatgaaacaatggttaaggtgagtgcataccttcttggggagtatggccac
ctattggcccgaagacctggttgcagtcctaaggagttgtttgctataataaatgacaag
cttccaacagtatcgacgagtactgtcgctattcttctgtcgacttatgccaagatactg
atgcacacacaaccccctgatgtgggactgcagcaacaaatcctgacaatattcaagaag
tacgagagttatattgatgttgaaatacagcagagagcagtcgaatattttgaactaagc
aggaaaggtgctgctttggcagacgtgttagcagaaatgccgaaatttcctgaacgtgag
tctgctctgttgaagaaggctgaagatgctgaggttgacacagcagagcaaagtgctata
aaattacgaagtcagcaacaaacatcgagtgctattgtcatagctgatcagccacctgta
aatggatcagtaccagcatctaatcatctcactcttgtgaagatgccaagtcaaaatatc
actgaagagagcaatgttgcttacgaagaacctccagtagaaattccgaaagaaaatggt
gctcctgttgaagttgagagtaaagtcgaaaatatcccagagaccaacattgagagcaag
gttgagcctcctgcagcgcatcctgcttctcaagcagacctccttgcagatcttttgggt
cctcttgcaatagagggtcctcctgctgctgtagaacaaaaccctgttcaaggactggag
actaatcaaagtccagttggtgatttggcactagcaacccttgaagatcagtcaaactca
gttcagcctattgtaaatgttgaggagaagtttcatatattatgctcaaaagatagtggg
gtactttatgaggatcctcacattcagattggtttaaaagcagagtggcgtgctcatcat
ggtcgtctcgtacttttcctgggaaacaaaaatacggcaccacttttatcagttcaggct
ctgattttgcctcctagccatttaaaaacggaactctcatcagttcctgatactattcct
ccaagagcacaggtccaaattccacttgaggttgtgaatcttcgtgcaagtagagatgtc
gctgttcttgatttttcatatacatttggaacttcactggtgaatgtcaaactccggctc
cctgttgtattgaataaatttttgcaacctataactctttcccctgaagagtttttccct
cagtggaaagcattgaatgttcaaaatctaaaagttcaagaagtggttaaaggtgtgaaa
ccattacctcttcctgagatagctagtcttttcatgagccttcacttggcggttgctcct
ggacttgataataacccgaacaatctggttgcatgcactacattcttttctgaaacaacc
cgtgccatgctttgtctggtcagaatcgaaactgatccacaagatagaacgcaactccgg
ctcacagtggcatcaggagatcagtatttgacattcgagttgaaagagtacatcaaggaa
catttaattgatatcccaagggtacaaacagcctcacctcccgttccggtgcagccacag
ttgcctccggcggcagtacctgccacatacaatgaccctggtgcaatgctagctgggttg
ctataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351755
Entry
4351755           CDS       T01015                                 
Name
(RefSeq) AP-2 complex subunit sigma
  KO
K11827  AP-2 complex subunit sigma-1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4351755
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4351755
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    4351755
SSDB
Motif
Pfam: Clat_adaptor_s
Other DBs
NCBI-GeneID: 4351755
NCBI-ProteinID: XP_015618362
UniProt: Q2QW51 Q0IPF9
LinkDB
Position
12:5602162..5606143
AA seq 142 aa
MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKFTNFVEFRTHKVIYR
RYAGLFFSMCVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFILA
GELQETSKRAIIERMGELEKLE
NT seq 429 nt   +upstreamnt  +downstreamnt
atgatccggttcatcctgctgcagaatcggcaggggaagacgcggctggccaagtactac
gtcccgctcgaggactcggagaagcacaaggtcgagtacgaggtgcatcggctggtggtc
aaccgggatcccaagttcaccaacttcgttgagttccggacgcataaagttatatacagg
cgatatgcaggactgtttttctcaatgtgtgtggatatcactgacaatgagttggcatac
ttggaatgcatccacttgtttgtcgagatattagatcatttcttcagcaatgtgtgtgaa
ctcgacttagtatttaatttccacaaggtttatttgatattggatgagtttattctcgct
ggagaacttcaagagacaagcaaaagggcaataatagagcgaatgggtgagcttgagaag
ctggaataa

DBGET integrated database retrieval system