KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330413
Entry
4330413           CDS       T01015                                 
Name
(RefSeq) phosphoribulokinase, chloroplastic
  KO
K00855  phosphoribulokinase [EC:2.7.1.19]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4330413
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.19  phosphoribulokinase
     4330413
SSDB
Motif
Pfam: PRK SCPU
Other DBs
NCBI-GeneID: 4330413
NCBI-ProteinID: XP_015625719
UniProt: Q6Z8F4 A3AAE2
LinkDB
Position
2:28701809..28704380
AA seq 403 aa
MAISSLHATTSLHSPCTTNTSFRQNQVIFFTTRSNRRGSTRYGGARTFQVSCSVDKPVVI
GLAADSGCGKSTFMRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRTGRK
EKGVTALDPRANDFDLMYEQVKAIKEGKAIEKPIYNHVTGLLDPPELIQPPKIFVIEGLH
PMFDERVRDLLDFSIYLDISDEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAFIDP
QKQYADAVIEVLPTQLIPDDNEGKVLRVKLIMKEGVKNFNPVYLFDEGSSITWVPCGRKL
TCSYPGIKFAYGPDTYFGHEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQMLK
HADFPGSNNGTGLFQTIVGLKIRDLYEQIIAERAGAPTEAAKV
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggcgatctccagcctacatgccaccacctccctgcactccccatgcaccaccaacaca
agcttcaggcagaatcaggtcatcttcttcaccaccagaagcaacaggaggggtagcaca
aggtacggaggagcaagaacctttcaggtttcatgctcagtcgacaagccagtggtgatt
ggccttgcagcagactcaggatgcgggaagagcacctttatgcgccggctcaccagtgtg
tttggtggtgctgcagagccacccaagggtggcaacccagactcaaacacactcatcagt
gacacgacaacggtgatatgcctcgatgactaccattccttggacaggactggcaggaag
gagaaaggtgtgactgccctggaccctagggcaaacgattttgatctcatgtatgagcag
gtgaaggcaatcaaagaaggcaaggcaattgagaagccaatctacaaccatgttactggt
ctcctagacccaccggagcttatccagccccccaagatttttgtcattgagggcttacat
cccatgtttgatgaacgtgtgagggacctcctagatttcagcatctacctggacatcagt
gacgaggttaaatttgcatggaaaattcagagggatatggcagagcgcggtcacagcctt
gaaagcatcaaggctagtatcgaagccaggaaaccagattttgatgccttcattgatccc
cagaagcaatatgctgatgcagtgattgaagttctgccaacccagcttattcctgatgac
aatgaaggaaaggtgctacgtgttaaattgatcatgaaagaaggtgtaaagaacttcaac
ccagtttacctcttcgacgaaggatcaagcatcacctgggtcccttgtggaagaaaactc
acatgttcttatcctggcatcaaatttgcctatggcccagacacttactttgggcatgag
gtatcagtgctggagatggatggccaatttgacagactagatgagcttatctatgttgag
agccatttaagcaacctctcaaccaaattttatggagaggtgacacagcaaatgctaaag
catgcagacttccccggcagcaacaatggaacaggtctcttccaaactatcgtaggactg
aagattagagatctctatgagcagattattgctgagagggccggtgcacctactgaagcg
gcaaaagtttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268984
Entry
9268984           CDS       T01015                                 
Name
(RefSeq) phosphoribulokinase, chloroplastic
  KO
K00855  phosphoribulokinase [EC:2.7.1.19]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    9268984
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.19  phosphoribulokinase
     9268984
SSDB
Motif
Pfam: PRK TsaE MobB MeaB
Other DBs
NCBI-GeneID: 9268984
NCBI-ProteinID: XP_015635122
UniProt: C7J1V7 A0A0P0WE66
LinkDB
Position
4:complement(30107205..30109891)
AA seq 402 aa
MAARSFSSASTTTILLRSGRWRRTMRAAAFPFRVSCSAAAAAAAGGTVVIGLAADSGCGK
TTFVRRLTSVLGAGTAAAAAPPWGGNPGSNTLLGDAATVICLDDYHSLDRAGRKERGVTA
LDPRANDFDLMYRQLKAIKEGRAVAKPIYNHATGLLDPPELITPPKILVVEGLHPMYDER
VRGLLDFSIYLDISSDIKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYAD
AVIEVLPTRLIAAADDDGDEGKVLRVKLIMKEGVEHFAPAYLFDEGSTISWIPCGRKLSC
SYPGIKFSYFPDTYFGHEVSVLEMDGKFDKLDELIYVESHLSNLSTKYYGEVTQQMLKHA
DFPGSNNGTGLFQTIVGLKIRDLYEQVVAERAASPPALAAVA
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggcggccaggtcgttcagctcggcgagcacgacgaccatcctgctgagaagcgggagg
tggaggaggacaatgagggcggcggcgttcccgttccgcgtgtcgtgctccgcggcggcg
gcggcggcggcgggcgggacggtggtgatcgggctggctgccgactccgggtgcgggaag
accacgttcgtgcgtcgcctgacgagcgtgctcggcgccggcaccgcggcggcggcggcg
cctccgtggggcggcaacccgggctccaacacgctcctcggcgacgccgccacggtgatc
tgcctcgacgactaccactcgctggaccgcgcggggcggaaggagaggggcgtgacggcg
ctggacccgcgcgccaacgacttcgacctcatgtaccggcagctgaaggccatcaaggag
ggccgcgccgtcgcgaagcccatctacaaccacgccacgggcctcctcgacccgccagag
ctcatcactccccccaagatcctcgtcgtcgagggcctgcacccaatgtatgatgagcgt
gtcaggggcctgctggacttcagcatctacctggacatcagcagcgacatcaagtttgca
tggaaaattcagagagacatggcagagcgtgggcacagcctggagagcatcaaggccagc
attgaagcccggaagcccgacttcgatgcgtatattgacccgcagaagcagtacgccgat
gccgtgatcgaggtcctgccgacgcggctgatcgccgccgcggacgacgacggcgacgaa
ggcaaggtgctgcgcgtgaagctgatcatgaaggaaggcgtcgagcacttcgcgccggcc
tacctcttcgacgaaggatcgaccatcagctggatcccctgcggcaggaagctctcctgc
tcctaccctggcatcaaattctcgtacttcccggacacctacttcggccacgaggtttcg
gtgctggagatggacgggaagttcgacaagctggacgagctgatctacgtggagagtcac
ctcagcaacctgtcgaccaagtactacggagaggtgacgcagcagatgctgaagcacgcc
gacttccccgggagcaacaacggcacggggctcttccagaccatcgtcgggctcaagatc
agggacctctacgagcaggtcgtcgccgagagggccgcttcgccgccggcactggctgcc
gttgcctga

DBGET integrated database retrieval system