KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330482
Entry
4330482           CDS       T01015                                 
Name
(RefSeq) histidinol-phosphate aminotransferase, chloroplastic
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00340  Histidine metabolism
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa00960  Tropane, piperidine and pyridine alkaloid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    4330482
   00350 Tyrosine metabolism
    4330482
   00360 Phenylalanine metabolism
    4330482
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4330482
  09110 Biosynthesis of other secondary metabolites
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    4330482
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4330482
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     4330482
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class II
   4330482
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C
Other DBs
NCBI-GeneID: 4330482
NCBI-ProteinID: XP_015623090
UniProt: Q0DY86 A0A0P0VNN7
LinkDB
Position
2:complement(29324708..29328626)
AA seq 425 aa
MDFSVRARIQSPHRSAAHFVAGEGGRRRPATSRVSFRSMASAASVEEPAAAAAAAAETKR
GPSGASFIREHLRSLAPYQPILPFEVLSARLGRKPEDIIKLDANENPYGPPPEVAKALGN
LKFPYVYPDPESRQLRAALAEDSGLESEYILAGCGADELIDLIMRCVLEPGDKIVDCPPT
FTMYEFDASVNGALVIKVPRLPDFSLDVAQIVKVVEQEKPKSIFLTSPNNPDGSIINDED
LLKILDLPILVVLDEAYIEFSSLQTRMSWVKKHDNLIVLRTFSKRAGLAGLRVGYGAFPL
SIIEYLWRAKQPYNVSVAAEVSACAALQNPTYLEEVKNLLLQERDRLYDLLKEIPFLKPF
PSHSNFILCEVTSGKDAKKIKEDLAKMGVMIRHYDKKELKGYIRISVGKPEHTDALMKGL
KALQL
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggatttcagcgtccgagctcgcatccagagcccgcaccggtcggccgcccacttcgtc
gccggcgaggggggacgccgccgcccggcaacgtccagggtatccttccgctccatggcg
tcggccgcttccgtggaggagcctgccgctgctgcggcggcggcggctgagacgaagagg
ggaccgagcggcgcctccttcatccgggaacacctcaggagtctcgccccgtaccagccc
atcctgcccttcgaggtgttgtccgctcggcttgggcgtaaaccagaggatataatcaag
ttggatgcaaatgaaaatccatatggtccacctccggaggtagctaaagcattaggaaat
ttgaagtttccctatgtgtaccctgatcctgaaagccgtcagttgcgtgctgctcttgct
gaagattctggtcttgaatctgagtacatacttgctggatgtggtgcagatgaattaatt
gatttaataatgagatgtgtactcgaaccaggtgacaaaattgttgattgccctccaact
tttacgatgtatgagtttgatgcgtcagtcaatggtgcacttgtgatcaaggtaccgaga
cttcctgatttttctctagacgttgcacagattgtcaaagtggttgaacaggaaaagcca
aaatccatatttctgacatctccgaacaacccagatggcagcataatcaatgatgaggat
cttttaaagatccttgatcttccaatacttgtagtgctggatgaagcatatattgagttt
tcgagtcttcaaacaaggatgtcatgggttaagaagcatgataatttgattgttcttcgg
acatttagcaaacgagcaggtttagctggacttcgtgtgggttacggagcatttcctcta
agcataatcgagtatttatggagggctaagcagccctataatgtttctgtagcagcagaa
gtttcagcctgtgctgccttgcagaacccgacttatttagaggaagtgaaaaatctgcta
ctacaagagagggacaggctgtacgatcttctcaaagaaataccattcctaaagccattt
cccagccactctaactttattctctgcgaggtcacatcaggcaaagatgcaaagaaaata
aaggaagaccttgcgaagatgggagtaatgatccgccactatgacaagaaggaactaaag
ggatatattcgtatttcagtgggcaagccagagcataccgatgcactaatgaaaggcctg
aaagcacttcaactgtga

DBGET integrated database retrieval system