KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330491
Entry
4330491           CDS       T01015                                 
Name
(RefSeq) ATP-dependent DNA helicase homolog RECG, chloroplastic isoform X1
  KO
K03655  ATP-dependent DNA helicase RecG [EC:5.6.2.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4330491
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4330491
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     4330491
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     4330491
SSDB
Motif
Pfam: Helicase_C DEAD RecG_dom3_C ResIII
Other DBs
NCBI-GeneID: 4330491
NCBI-ProteinID: XP_015627607
LinkDB
Position
2:29441680..29451472
AA seq 983 aa
MIASSSAQSWIKGHTNQLARVFSLDFRRGRSRRIPSRMRSSNALGSKLFRWCSRENHTSV
RKLLEVDGTSERSKLLNKVSVLMGYSNTQELIEQERARRGSATELISVCKEIEFPEMCAK
FPCIKIGDSSPIELYAAAASMSQKETVLSENLTNFMRESGGNFGAAYEFSDKCHPLDPTL
TNVDHLSISEESSLTAQFVSLEPAVDTDACPESLAVADATVSDSSILDRSIRCFPGTTSR
QYRQLEDGGFHTVRKLLQHFPRTYADLQNPQGSIEEGQYIMLFGTVVSSRGARLKHTLGY
LEVVVSCSIIESELSSSVKSCNSQAEQKKTIHLHLKKFFSGTRFSSPSFLKCISSKYKEG
DLAYVSGKIKKALTKDHYDLREYTIDMLEEEEQQCTLLDRKPYPIYPSKAGLKPSLLSLS
ISRALKMLTPDIDPMPHEVLVEFNLPNLFDAYMGIHKPKNRDEADFARRRLIFDDFFYLQ
LGRLFQMLEAVGTRVEKEELLLKCKNHELNAVGADEWSPLARKLLKVLPYLLTPSQLNAV
KEIIWDLRRPVPMNRLLQGDVGCGKTVVAFLACMEVISSGFQAAFMVPTEVLALQHYEHL
TSLLEKFDGDECKPNIALLTGSTSTRESRIIRNGLKTGEIAMVIGTHSLIGDKTEFSALR
ISVIDEQQRFGVVQRGRFNSKLYTPSTKSSDDDTISDENSASEIFMAPHVLAMSATPIPR
TLALALYGDMSLTQITDLPPGRQPIETLALEGNDAGFESVFQMMSDELVDGGKVYLVYPI
IEESEQLPQLHAAKAEFDSIKQKFEGYPCGLLHGRMRSDEKDGALSSFRSGETRILLSTQ
VIEIGVDVPDASMMVVMNAERFGMSQLHQLRGRVGRGERKSRCVFLCSTPSALPRLKVLE
KSSDGFYLANADLLLRGPGDLLGKKQSGHLPEFPIARLEIDGSILQEAHLAALNVLGTSN
DLAQFPGLKVELSMRQPLCILGD
NT seq 2952 nt   +upstreamnt  +downstreamnt
atgatcgcctcctcctcagcgcaatcatggattaagggtcacaccaatcaattagcgagg
gtgttttctttggattttcgcagagggcgctctagaaggattccttccagaatgaggtct
agcaatgctcttggctctaagctcttccggtggtgttcgcgcgagaatcacacgtccgtc
aggaagctgttggaggtggatggcacgtcagagagatcaaaactcctgaacaaagtgtct
gttttgatgggttatagtaatacacaagaattaattgagcaagaaagagcccgcagagga
tctgctacagaattgatcagtgtatgcaaagaaattgagttcccagaaatgtgtgcaaag
tttccatgcataaaaattggtgattcatcacctattgaactatatgctgctgctgctagc
atgagtcagaaagaaactgtgctttctgaaaacctcacgaatttcatgcgagagtccggt
ggaaattttggggcagcttatgagttttctgacaaatgccatccattagatccaaccctt
acaaacgtcgatcacctatcaatcagtgaagagagttctctcacagcacagtttgtttct
cttgaaccggcagttgataccgatgcttgtccagagtcattggcagtggcagatgctaca
gtttctgattctagcatcttggacagaagtataagatgttttcccggaacaactagtagg
caatatcgccagctagaggatggtggtttccatacggtacggaaattgttgcagcatttt
ccccggacctatgcagatctacaaaatcctcaaggttcaatagaagaggggcagtacatc
atgctgtttggaaccgttgtatcttccaggggagccagacttaagcacactttaggttac
cttgaggttgttgttagttgttcaataatcgagagtgagttaagctcttcagttaagagt
tgtaactctcaagcagaacaaaagaagacaattcatttgcacctcaagaaatttttcagc
ggcacacgcttctcttctccatcttttcttaagtgtatatcatcgaagtacaaagagggg
gatcttgcttatgtcagcggtaagatcaagaaggcgcttactaaagaccattatgatttg
agagagtacactattgacatgcttgaagaagaggaacaacaatgcaccctgcttgacagg
aaaccatatcctatatacccatcaaaagcaggattgaaaccaagtttgctgagcctctcc
atctcaagggccttgaagatgctgacgccagacattgaccctatgcctcatgaagttctt
gttgaattcaacttgcccaatctctttgatgcttacatgggaatccacaagcctaagaat
cgagatgaagccgattttgctcggagaaggcttattttcgatgatttcttttatcttcag
ttgggaagactgtttcaaatgcttgaagctgttggtacacgggttgagaaggaagaattg
ttattgaagtgcaaaaatcatgagctaaatgctgttggtgctgacgagtggtctcctctt
gcaaggaaattgttaaaagttcttccttatttgcttactcctagtcaattgaatgctgtt
aaagagattatatgggatctcagaagaccagttcctatgaacagactcttgcaaggtgat
gttggttgtggtaaaaccgtagttgctttccttgcatgcatggaggtcattagctcagga
tttcaggctgctttcatggttccaacggaggttcttgccctccagcattatgaacatcta
acttcattgctggagaagtttgatggagatgaatgcaaaccaaacattgctttactaact
ggttcaacttccacgagggaatcaaggattattcgaaatggtctcaagacaggagaaata
gcaatggtcattggaacacacagcttaattggtgataaaaccgaattctcagctttgcgc
atctctgttatagatgagcagcagcgctttggtgttgttcaaagaggaaggtttaatagt
aagctatataccccttccacgaaatcgagtgatgatgatacaatctcagacgagaattcc
gcttctgaaatatttatggctccccatgttcttgctatgtccgctactccaatcccaaga
acgttggctcttgctctgtatggggacatgtcccttacacagatcacggacttgcctcca
ggaagacaacctatagaaactcttgctcttgaaggaaatgatgctggttttgaatctgtc
ttccagatgatgagtgatgaactggttgatggaggcaaggtctacctcgtatatcctatc
atagaagaatcagagcagctaccacaacttcatgcagcaaaagccgagtttgattccata
aagcaaaaatttgaaggttatccctgtgggctgttgcacggtcgcatgaggagcgatgag
aaggatggagccctcagcagttttagatccggggaaacacgtattctcctctcaacacaa
gtgattgagattggagtcgatgttcctgatgcttccatgatggttgtcatgaatgctgag
agatttggaatgtctcagctgcaccagttaaggggtcgggtagggcgtggcgaaaggaaa
tccagatgtgtgttcctatgctccactcctagcgcgctgccaaggttgaaggtgcttgag
aagtcatccgatggattctacttggctaacgccgacctgctactgcgtggccctggtgat
ctactcggcaagaaacagtcagggcatcttccagagtttccaatagctagactggagatt
gatggcagtattctacaagaagctcatcttgctgcacttaacgttttgggaacaagcaac
gaccttgcacaatttccaggactaaaagttgagctcagcatgagacaaccgctgtgcatt
cttggagattga

DBGET integrated database retrieval system