KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330533
Entry
4330533           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L31
  KO
K02910  large subunit ribosomal protein L31e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4330533
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4330533
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4330533
  Archaea
    4330533
SSDB
Motif
Pfam: Ribosomal_L31e M20_dimer DUF1104
Other DBs
NCBI-GeneID: 4330533
NCBI-ProteinID: XP_015626804
UniProt: Q6ZGV5
LinkDB
Position
2:complement(29795444..29797255)
AA seq 123 aa
MSEKKRGAGTRKDEVVTREYTINLHKRLHGCTFKKKAPNAIKEIRKFAQKAMGTTDIRID
VKLNKAIWTNGIRSVPRRVRVRISRKRNDEEDAKEELYSLVTVAEIPAEGLKGLGTKVVE
DEE
NT seq 372 nt   +upstreamnt  +downstreamnt
atgtcggagaagaagcgcggcgccggcacccgcaaggacgaggtggtgacccgcgagtac
accatcaacctccacaagcgtctccacggatgcaccttcaagaagaaggcgccgaatgcc
atcaaggagatcaggaagtttgcacagaaggccatgggcacaacggatatacgcatcgac
gtgaagcttaacaaggccatctggaccaatggtatccggagtgtcccaaggcgagtccgt
gttagaatctctcgcaagagaaacgatgaggaggacgccaaggaggagctctactctctg
gtcacagttgctgagatccctgcagagggtctcaagggtttgggaaccaaggttgttgag
gatgaggagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340887
Entry
4340887           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L31
  KO
K02910  large subunit ribosomal protein L31e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4340887
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4340887
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4340887
  Archaea
    4340887
SSDB
Motif
Pfam: Ribosomal_L31e M20_dimer DUF1104 CPT_N
Other DBs
NCBI-GeneID: 4340887
NCBI-ProteinID: XP_015640972
UniProt: A0A0P0WWE5
LinkDB
Position
6:12412509..12415279
AA seq 124 aa
MAEKKQRPGGARKDEVVTREYTINLHKRLHGCTFKKKAPNAIKEIRKFAQKAMGTIDVRV
DVKLNKHIWSSGIRSVPRRVRVRIARRRNDEEDAKEELYSLVTVAEVPQEGLKGLGTKLV
EDDE
NT seq 375 nt   +upstreamnt  +downstreamnt
atggcggagaagaagcagcgccccggcggcgcgaggaaggacgaggtggtcacccgcgag
tacaccatcaacctccacaagcgcctccacggatgcaccttcaagaagaaggctcctaat
gccatcaaggagatcaggaagtttgcacagaaggccatgggcaccattgacgtcagggtt
gatgtgaagctcaacaagcacatctggagcagcggtatccggagcgttccaaggcgtgtc
cgtgtcagaattgcccgcaggaggaacgacgaggaggatgcgaaggaggagctctactct
ctggtcactgttgctgaggttccccaagaggggttgaagggcctgggtaccaagcttgtc
gaggacgatgagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345976
Entry
4345976           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L31
  KO
K02910  large subunit ribosomal protein L31e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4345976
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4345976
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4345976
  Archaea
    4345976
SSDB
Motif
Pfam: Ribosomal_L31e M20_dimer DUF1104
Other DBs
NCBI-GeneID: 4345976
NCBI-ProteinID: XP_015650376
UniProt: Q6ZK77
LinkDB
Position
8:complement(24992943..24994517)
AA seq 122 aa
MVEKKGGAARKEEVVTREYTINLHKRLHSCTFKKKAPNAIKEIRKFAQKAMGTTDVRVDV
KLNKHIWSSGIRSVPRRVRVRIARKRNDEEDAKEELYSLVTVAEVPPEGLKGLGTKVVDE
TD
NT seq 369 nt   +upstreamnt  +downstreamnt
atggtggagaagaagggaggagcggcgaggaaggaggaggtggtgacgagggagtacacc
atcaacctccacaagcgcctccacagctgtacattcaagaagaaggcgcccaatgccatc
aaagagatcaggaagtttgcgcagaaggctatgggcactacagatgtcagggtcgatgtg
aagctcaacaagcacatctggagcagtgggatcaggagtgtgccgcggagggttcgtgtg
aggatcgcccgcaagaggaatgacgaggaggatgccaaggaagagctctactctctggtc
actgtggccgaggtccctcctgagggtttgaaggggctgggaaccaaggttgttgacgaa
acggattaa

DBGET integrated database retrieval system