KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330657
Entry
4330657           CDS       T01015                                 
Name
(RefSeq) dihydropyrimidine dehydrogenase (NADP(+)), chloroplastic
  KO
K00207  dihydropyrimidine dehydrogenase (NADP+) [EC:1.3.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa00410  beta-Alanine metabolism
osa00770  Pantothenate and CoA biosynthesis
osa01100  Metabolic pathways
Module
osa_M00046  Pyrimidine degradation, uracil => beta-alanine, thymine => 3-aminoisobutanoate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4330657
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4330657
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4330657
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.2  dihydropyrimidine dehydrogenase (NADP+)
     4330657
SSDB
Motif
Pfam: DHO_dh Dus Glu_synthase FMN_dh
Other DBs
NCBI-GeneID: 4330657
NCBI-ProteinID: XP_015627074
UniProt: A0A0A0QMT3 Q6Z744
LinkDB
Position
2:complement(30745579..30749371)
AA seq 414 aa
MESLTLRASPSTAAPLRRVPGRRHAAVSVRASAGAGEPDLSVRVNGLKMPNPFVIGSGPP
GTNYTVMKRAFDEGWGGVIAKTVSLDAEKVINVTPRYARLRADPNGSTKSPIIGWQNIEL
ISDRPLETMLNEFKQLKKEYPDRILIGSIMEEYNKAAWHELIERVEESGVDALEINFSCP
HGMPERKMGAAVGQDCDLLEEVCGWINEKATVPVWAKMTPNITDITKPARISLKSGCEGV
SAINTIMSVMGINLKTLRPEPCVEGYSTPGGYSARAVHPIALAKVMQIARMMKEEFADGQ
SLSAIGGVETGNDAAEFILLGADTVQVCTGVMMHGYGLVKKLCAELQDFMRQHNFSSIED
FRGASLPYFTTHTDLVHRQREAINQRKAIRKGLESDKDWTGDGFVKETESMVSN
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggagtcgctgactctccgggcatcgccgtcgacggccgcgccgttgcgccgcgtcccc
gggcggcggcacgcggcggtgtccgtccgcgcctccgccggcgccggcgagccggacctc
tccgtgcgcgtgaacgggctgaagatgcccaacccgttcgtgatcgggtcggggcccccg
ggcaccaactacaccgtcatgaagcgcgcgttcgacgaggggtggggcggcgtcatcgcc
aaaaccgtatccttggatgctgagaaagttatcaacgtaacccctcgctatgcccggctc
agggcggaccccaatggatctactaagagtcctatcatcggatggcagaacattgaactt
atcagtgatcggcctctagaaactatgctgaatgaattcaagcaactgaagaaagagtat
cctgacaggatactcattggctcaataatggaggagtacaacaaagctgcatggcatgag
cttattgaacgcgttgaagagagcggagtggatgctcttgagattaatttctcatgccca
catggcatgccagagcgaaaaatgggtgctgccgtgggacaagactgtgacttgttagag
gaggtctgcggttggataaatgagaaggctacagtgcctgtttgggcaaagatgactcct
aacattacagatattacaaagcctgcaagaatttctcttaagtcaggatgtgaaggagtt
tctgctattaacacaatcatgagtgtgatgggaattaacctcaaaactttgcgaccagaa
ccttgtgtggagggttattccacgcctggaggctattctgcgagagccgtgcaccctata
gcacttgcgaaagtcatgcagatagcaaggatgatgaaagaagaatttgctgatggacag
tcactctctgctattggaggcgtggagactggcaatgatgctgctgagtttattctactt
ggcgcagatacagtacaggtatgtacgggcgtaatgatgcatggttatggccttgtaaag
aagctttgtgcagagctgcaggattttatgagacaacacaacttttcctcaatagaagat
ttccggggggcctctctcccgtatttcaccacacacaccgatttggtacatcggcaaagg
gaggcgatcaaccagaggaaggctattaggaagggcctggaatcagacaaggactggacc
ggtgatggattcgtcaaggagacagaaagcatggtgtccaactga

DBGET integrated database retrieval system