KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330763
Entry
4330763           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L29, chloroplastic
  KO
K02904  large subunit ribosomal protein L29
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4330763
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4330763
Ribosome [BR:osa03011]
 Ribosomal proteins
  Bacteria
   Large subunit
    4330763
  Archaea
    4330763
SSDB
Motif
Pfam: Ribosomal_L29
Other DBs
NCBI-GeneID: 4330763
NCBI-ProteinID: XP_015623221
UniProt: Q0DXH1 Q6Z6A0
LinkDB
Position
2:31719716..31721473
AA seq 165 aa
MATMSLAAASPLASTPRGLAVSTPRTAFLGLLTGGASLAPFPGLAAAAAPPRLPAGRGDA
AVARMAKREQELEEIRAMPTEKIEEEVVDLKGELFMLRLKRSARQEFKSSEFGRMRKRIA
RMLTVKREREIEQGINKRLSRKLDRKWKQSIVVRPPPSLRENKEE
NT seq 498 nt   +upstreamnt  +downstreamnt
atggcgacgatgtccctcgccgcggcgtcccccctcgcctcgactccccgtgggctcgcc
gtctccactccccgcacggccttcctcggcctcctgaccggaggggcgtcgctggcgccg
ttcccgggactggcggcggcggcggcgccgccgcggctgccagcggggaggggcgacgcg
gccgtggccaggatggcgaagagggagcaggagctggaggagattcgggccatgccgacg
gagaagatcgaggaggaagtggtggacctgaagggggagctcttcatgctccgcctcaag
cgctccgcgcgccaggagttcaaatccagcgagttcggccgcatgcgcaagaggattgct
cgtatgctgactgtcaaaagagaacgggaaattgaacaaggaatcaacaagagattgtct
aggaagcttgacaggaaatggaagcaaagcatcgtggttagaccaccaccatctctaagg
gagaacaaggaggaatag

DBGET integrated database retrieval system