KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330861
Entry
4330861           CDS       T01015                                 
Name
(RefSeq) proteasome subunit beta type-6
  KO
K02738  20S proteasome subunit beta 1 [EC:3.4.25.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4330861
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4330861
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4330861
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     4330861
Peptidases and inhibitors [BR:osa01002]
 Threonine peptidases
  Family T1: proteasome family
   4330861
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    4330861
SSDB
Motif
Pfam: Proteasome NblA
Other DBs
NCBI-GeneID: 4330861
NCBI-ProteinID: XP_015625800
UniProt: Q9LST9 A3ABR8
LinkDB
Position
2:complement(32465009..32468603)
AA seq 246 aa
MDASLMGAPSAAAGDNPTSGEHRMGTTIVGVCYDGGVVLAADSRTSTGMYVANRASDKIT
QLTDNVYICRSGSAADTQVISDYVRYFLHQHTIQLGQPATVKVAANLIRLLAYQNKNMLQ
AGMIVGGWDKYEGGQIFSVPLGGTILRQPFAIGGSGSSYLYGLLDHEWKEGMSQEEAEKF
VVKVVSLAIARDGASGGVVRTVTINADGVSRKFHPGDKLQLWHEELEPQNSLLDILAAGN
PDPMVQ
NT seq 741 nt   +upstreamnt  +downstreamnt
atggacgcctctctcatgggcgccccctccgccgcagcgggagacaatcccacctccggg
gagcaccggatggggaccaccatcgtcggcgtctgctacgacggcggcgtcgtcctcgcc
gccgattccagaaccagcaccggaatgtatgtggcaaaccgtgcgtcggacaagattact
cagctaactgacaatgtgtacatctgccgctctggatctgctgctgatacacaagtaatt
tccgattatgtacgctattttctccaccaacacacaattcagcttgggcagccagctacc
gtgaaagttgcagccaacttaattaggttgttggcttatcagaacaagaacatgttgcaa
gctggcatgattgttggtggatgggataaatatgagggaggccaaattttctcagtcccc
cttggtggaacaattctgaggcaaccatttgcaatcggaggttcaggctctagttacctc
tatggattgcttgaccacgaatggaaggagggcatgtcccaggaagaagctgagaagttt
gtggttaaggtagtttcccttgctatagcccgtgatggtgctagtggaggggttgttcgt
accgtcactataaacgcagatggtgtttcgaggaaatttcaccctggagacaaactacaa
ctgtggcatgaagagctggagccccagaactcgttgctggacatacttgcagctgggaac
cctgatccgatggtccaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340065
Entry
4340065           CDS       T01015                                 
Name
(RefSeq) proteasome subunit beta type-6
  KO
K02738  20S proteasome subunit beta 1 [EC:3.4.25.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4340065
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4340065
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4340065
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     4340065
Peptidases and inhibitors [BR:osa01002]
 Threonine peptidases
  Family T1: proteasome family
   4340065
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    4340065
SSDB
Motif
Pfam: Proteasome NblA
Other DBs
NCBI-GeneID: 4340065
NCBI-ProteinID: XP_015644439
UniProt: Q5VPF1 A0A0P0WSS1
LinkDB
Position
6:complement(2091240..2094689)
AA seq 246 aa
MDASLMGSPSPAAGDAPTSGEHRMGTTIVGVCYDGGVVLAADSRTSTGMYVANRASDKIT
QLTDNVYVCRSGSAADTQVISEYVRYFLHQHTIQLGQPATVKVAANLIRLLAYQNKNMLQ
AGMIVGGWDKYEGGQIFSVPLGGTILRQPFAIGGSGSSYLYGLLDHEWKEGMSQEEAEKF
VVKVVSLAIARDGASGGVVRTVTINADGVSRKFHPGDKLPLWHEEMEPQNSLLDILAAGN
PDPMVQ
NT seq 741 nt   +upstreamnt  +downstreamnt
atggacgcctctctcatgggctccccctctcccgccgcgggcgacgcccccacctccggg
gagcaccggatggggaccaccatcgtcggcgtctgctacgacggcggcgtcgtcctcgcc
gccgactcccggaccagcaccggaatgtatgtggcgaaccgtgcatctgacaaaattact
caactgactgacaatgtgtacgtctgccgctctggatctgctgccgacacacaagtcatt
tcggaatatgtacgctattttctccaccaacacacaattcagcttgggcaaccagctact
gtgaaagttgcagccaacttaattaggttgttggcttatcagaacaagaacatgttgcaa
gctggcatgattgttggtggatgggataaatatgagggtggccaaattttctcagtcccc
cttggtggaacaattctgaggcaaccatttgcaattggaggttctggttccagttacctg
tatggactgcttgaccatgaatggaaggagggcatgtcccaggaagaagctgagaagttt
gtggtgaaggtggtttcccttgctatagcccgtgatggtgctagtggaggggttgttcgt
acagtcaccataaatgccgatggtgtttcgaggaaatttcaccctggtgacaaactacca
ctctggcatgaagagatggagccccagaactcgttgctcgacatacttgctgctgggaac
cctgatccgatggtccagtga

DBGET integrated database retrieval system