KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330888
Entry
4330888           CDS       T01015                                 
Name
(RefSeq) heat shock 70 kDa protein, mitochondrial
  KO
K04043  molecular chaperone DnaK
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4330888
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4330888
   03110 Chaperones and folding catalysts [BR:osa03110]
    4330888
   03029 Mitochondrial biogenesis [BR:osa03029]
    4330888
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4330888
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     4330888
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP70 / DNAK
   4330888
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    4330888
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    4330888
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4330888
  Exosomal proteins of breast cancer cells
   4330888
  Exosomal proteins of colorectal cancer cells
   4330888
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C FtsA Fusion_gly Dynamin_M
Other DBs
NCBI-GeneID: 4330888
NCBI-ProteinID: XP_015626014
UniProt: Q0DX50
LinkDB
Position
2:complement(32688693..32693125)
AA seq 679 aa
MAASLLLRAARRRDLASPLGTLTANAQSAYSANICSQWGSFARAFSVKPTGNEVIGIDLG
TTNSCVSVMEGKNPKVIENSEGTRTTPSVVAFNQKGERLVGTPAKRQAVTNPQNTFFGTK
RLIGRRFEDPQTQKEMKMVPYKIVKAPNGDAWVETTDGKQYSPSQIGAFVLTKMKETAES
YLGKTVSKAVITVPAYFNDAQRQATKDAGRIAGLDVQRIINEPTAAALSYGTNNKEGLIA
VFDLGGGTFDVSILEISNGVFEVKATNGDTFLGGEDFDNTLLEFLVSEFKRSEAIDLAKD
RLALQRLREAAEKAKIELSSTAQTEINLPFITADASGAKHLNITLTRSKFESLVNSLIER
TREPCKNCLKDAGITTKEVDEVLLVGGMTRVPKVQEIVSEIFGKSPSKGVNPDEAVAMGA
AIQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQ
VGIRVLQGEREMATDNKLLGEFDLVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKSTGK
EQQITIRSSGGLSEAEIQKMVQEAELHSQKDQERKALIDIRNNADTTIYSVEKSLGEYRD
KIPAEVATEIETAIADLRSVMTSDDIEKIKANIEAANKAVSKIGQHMSGGGGGAGGSETG
GSQGGGEQAPEAEYEEVKK
NT seq 2040 nt   +upstreamnt  +downstreamnt
atggcggcgtcgctgcttctccgagccgcccgccggcgagacctcgcctcgcccctcgga
acgttgaccgccaatgctcaatcggcatattctgcgaatatttgttcacaatggggtagt
tttgcaagagctttcagtgtaaaaccaactggaaacgaggttattggaattgatttggga
acaactaattcttgtgtttctgttatggagggaaagaaccccaaagtgatagagaattca
gaaggcaccaggacaacaccatcagttgtggcctttaatcagaagggagagcgacttgtt
ggaactccagccaagcgtcaagcagtgaccaacccacaaaacactttctttggcacaaaa
cgtctgattgggagacgctttgaggatccacaaacacagaaagagatgaaaatggtacca
tacaaaattgtgaaggctccaaatggtgatgcttgggtggaaacaacagatggcaagcag
tactcaccaagtcagattggcgcatttgttttgaccaagatgaaggagactgctgaatct
taccttggtaaaactgtttcaaaggccgtgattacagttccagcttattttaatgatgct
cagcgtcaggcaaccaaggatgctggtcgcattgctggacttgatgtccagaggatcatc
aatgaaccaactgctgctgctttgtcttatggaacaaacaacaaggagggtttgatagct
gtgtttgacctgggaggaggtacctttgatgtctcaattcttgaaatctccaatggggtg
ttcgaggtcaaagcaacaaatggtgacacttttctgggaggagaagactttgataacact
cttttggagttcttggtgagtgaattcaagaggagtgaagctattgatctggcaaaggac
aggctggctctgcagaggttacgtgaagctgctgagaaggctaaaattgaactctcatcg
actgcccagaccgagattaaccttccattcatcacagctgatgcttctggagctaaacat
ttgaacattacacttacaagatcaaagtttgaatctttggtgaatagcctcatcgagagg
accagagagccatgcaagaattgcttgaaggatgctggtataactaccaaggaggttgat
gaggtccttcttgttggtggaatgacaagagttccaaaagtgcaggaaattgtttcagag
atttttggcaagtccccaagcaaaggggtcaacccagatgaagctgtagccatgggtgca
gccatacagggtggtattctccgtggagatgtaaaggagctgcttctccttgatgtgacc
cccctttcacttggtatcgagactcttggtggtatcttcaccagactgattaaccggaac
actacaatccccacgaagaaaagtcaggtgttctccactgctgctgacaaccagacacaa
gtgggcattcgtgtcttgcaaggtgagcgtgagatggcgacagacaacaagcttcttggt
gagtttgatcttgttggcattccaccagcgccaagaggtatgccacagatcgaggtcaca
tttgacatcgatgccaatggaattgtgacggtctctgcaaaagacaagtctaccgggaag
gagcagcaaatcaccatccgatcctccggtggcctctcagaagctgagattcagaagatg
gtccaggaggctgagcttcactctcagaaggatcaggagcggaaagccctcattgacatc
agaaacaacgctgacactaccatttacagcgttgagaaaagtctgggagagtacagggac
aagattcctgcagaggttgccactgagattgagacagcaatcgccgatctccgctctgtg
atgacctcagatgacatcgagaagatcaaggccaatatcgaagcggccaacaaggctgtt
tcaaagattgggcagcatatgtctggtggtggtggtggcgcaggcggttcagagacagga
ggatctcagggcggaggcgagcaggctccagaggctgagtacgaggaggtcaagaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331379
Entry
4331379           CDS       T01015                                 
Name
(RefSeq) heat shock 70 kDa protein, mitochondrial
  KO
K04043  molecular chaperone DnaK
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4331379
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4331379
   03110 Chaperones and folding catalysts [BR:osa03110]
    4331379
   03029 Mitochondrial biogenesis [BR:osa03029]
    4331379
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4331379
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     4331379
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP70 / DNAK
   4331379
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    4331379
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    4331379
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4331379
  Exosomal proteins of breast cancer cells
   4331379
  Exosomal proteins of colorectal cancer cells
   4331379
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C FtsA Fusion_gly Dynamin_M
Other DBs
NCBI-GeneID: 4331379
NCBI-ProteinID: XP_015632218
UniProt: A0A8J8Y932 Q10SR3
LinkDB
Position
3:complement(766759..771260)
AA seq 676 aa
MAASLLLRAVRRRDLASPLGTLTANVQSKCAANVCSRWAGFARTFSAKATGNEVIGIDLG
TTNSCVSVMEGKNPKVIENSEGTRTTPSVVAFNQKGELLVGTPAKRQAVTNPQNTFFGTK
RLIGRRFDDPQTQKEMKMVPYKIVKALNGDAWLETTDGKQYSPSQIGAFVLTKMKETAES
YLGKSVSKAVITVPAYFNDAQRQATKDAGRIAGLDVQRIINEPTAAALSYGTNNKEGLIA
VFDLGGGTFDVSILEISNGVFEVKATNGDTFLGGEDFDNTLLEFLVSEFKRTEGIDLSKD
RLALQRLREAAEKAKIELSSTAQTEINLPFITADSSGAKHLNITLTRSKFESLVNSLIER
TRDPCKSCLKDAGITTKDVDEVLLVGGMTRVPKVQEVVSEIFGKAPSKGVNPDEAVAMGA
AIQGGILRGDVKDLLLLDVTPLSLGIETLGGIFTRLINRNTTVPTKKSQVFSTAADNQTQ
VGIKVLQGEREMAADNKLLGEFDLVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGK
EQQITIRSSGGLSEAEIQKMVHEAELHSQKDQERKALIDIRNTADTTIYSIEKSLGEYRD
KIPAEVASEIETAIADLRNEMASDDIEKIKSKIEAANKAVSKIGQHMSGGGSGGSQAGSQ
GGGDQAPEAEYEEVKK
NT seq 2031 nt   +upstreamnt  +downstreamnt
atggcggcgtcgctgcttctccgcgccgtgcgccggcgagacctcgcgtctcctctcggg
accttgaccgcgaacgtccagtcaaagtgtgctgcaaatgtgtgttcaagatgggctggt
tttgcaagaactttcagtgcaaaagcaactggaaatgaggttattggaattgatttagga
acaactaactcatgtgtttcagttatggaaggaaagaacccaaaagtaatagagaattca
gaaggaaccaggacaacaccgtcagtagttgctttcaatcagaagggagagctacttgtt
ggaacaccagccaagcgtcaagcagtgaccaacccacagaacactttctttggtacaaag
cgtctgatagggcggcgctttgatgacccgcaaactcagaaagagatgaaaatggtacca
tataaaattgtgaaggctctgaatggtgatgcttggctagagacaacagatggcaagcag
tactcaccgagccagattggtgcctttgttttgaccaagatgaaggagacagctgaatct
taccttggaaaatctgtttccaaggctgtgattactgttccagcttatttcaatgatgct
cagcgtcaggctaccaaggatgctggtcgcatcgctggacttgatgtccaaagaatcatc
aatgaacccactgctgctgctctgtcttatggaacaaacaacaaggagggtttgatcgct
gtgtttgaccttggaggaggaacatttgatgtgtccattctagaaatatccaatggagtt
tttgaggtcaaagcaacaaatggtgacacttttctgggtggagaagactttgataatact
cttttggagtttttagtaagtgagttcaaaagaactgaaggtattgatctgtcaaaagac
agactggctctgcagaggctacgcgaagcagctgagaaagcaaaaattgaactctcatca
acagcccagaccgagattaatcttccattcatcacagctgattcctctggagcaaagcat
ctaaatatcacattgacaagatcgaagtttgaaagtttggtgaatagtctgattgagagg
actagagacccatgcaagagctgcttgaaggatgctggtataactactaaagatgttgat
gaggtccttcttgttggtggcatgacaagggttccaaaagtgcaggaagttgtttctgaa
atctttggtaaggcccctagcaaaggagtaaacccagatgaagctgtggccatgggtgct
gctattcagggcggcattctccgtggagatgtaaaggatcttctcctccttgatgtaacc
cctctatcgcttggtatcgagactcttggtggtatcttcaccagactaatcaacaggaac
actacagtccccacgaagaaaagtcaggtgttctcaactgctgctgacaaccagacgcaa
gtgggtattaaggtgttgcaaggtgagcgtgagatggcagcagacaacaaacttcttggt
gagtttgaccttgttggcattccaccagcgccaagaggtatgccacagattgaggtcaca
ttcgacatcgatgccaatggaatcgtgacggtctcagcaaaggataaggcaactggaaag
gagcagcagatcacaattcgatcctctggtgggctttctgaggctgagatccagaagatg
gtccatgaggctgagctgcactcccagaaggatcaagaacggaaagccctcatcgacatc
agaaacaccgcagacacaaccatctacagcatagagaaaagtctgggtgagtacagggac
aagatacctgcagaggttgcctccgagatcgagacggcgattgccgatctccgcaatgag
atggcctcggatgacattgagaagataaagagcaagatcgaagcggccaacaaggctgtc
tcaaagattgggcaacacatgtctggtggtgggtctggtggctcgcaagcaggatcacag
ggcggaggtgaccaggctcctgaggctgagtatgaggaggtcaagaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270165
Entry
9270165           CDS       T01015                                 
Name
(RefSeq) heat shock 70 kDa protein, mitochondrial
  KO
K04043  molecular chaperone DnaK
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    9270165
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    9270165
   03110 Chaperones and folding catalysts [BR:osa03110]
    9270165
   03029 Mitochondrial biogenesis [BR:osa03029]
    9270165
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    9270165
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     9270165
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP70 / DNAK
   9270165
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    9270165
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    9270165
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9270165
  Exosomal proteins of breast cancer cells
   9270165
  Exosomal proteins of colorectal cancer cells
   9270165
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C FtsA Serglycin Phasin
Other DBs
NCBI-GeneID: 9270165
NCBI-ProteinID: XP_015611783
UniProt: A0A0P0XPB1 B9G4B3
LinkDB
Position
9:complement(18987952..18991156)
AA seq 684 aa
MAIGSLIASRLARSTGHALASAASQAPMARHAAASPLLSRLGSVARAFSSKPAAADVIGI
DLGTTNSCVSVMEGKTPRVIENAEGARTTPSIVAKNQNGDLLVGITASRQAVTNAQNTVR
GSKRLIGRTFDDPQTQKEMKMVPYKIVRGPNGDAWVEMGGQQYSPSQIGAFVLTKMKETA
EAFLGKTVSKAVITVPAYFNDAQRQATKDAGRIAGLEVMRIINEPTAAALSYGMNNKEGL
IAVFDLGGGTFDVSILEISNGVFEVKATNGDTFLGGEDFDGALLDYLVSEFKKSDNIDLS
KDKLALQRLREAAEKAKVELSSTMQTEINLPFITADATGAKHFNITLTRSKFESLVQSLI
ERTRIPCVNCLKDAGVSAKDIDEVLLVGGMTRVPKVQDIVSQIFNKTPSKGVNPDEAVAM
GAAIQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQ
TQVGIKVLQGEREMATDNKLLGEFQLEGIPPAPRGMPQIEVTFDIDANGIVKVSAKDKST
GKEQEITIKSSGGLSESDIEKMVREAELHSQKDQERKSLIDLKNSADTTIYSIEKSVSEY
KDKVPAEVTNEIQSAVSDLRAAMAEDDLEKIKQKLEAANKAVSKIGEHMQQGGGGGSGGG
SSSSSGGDQTPEAEYQDAAKEAKM
NT seq 2055 nt   +upstreamnt  +downstreamnt
atggccatcggatctctcatcgcgtcgaggctggccaggtccaccggccacgccctcgcc
tccgccgcctctcaggctccgatggcccgtcacgcggcggcgtctcctctgttgtccagg
cttggatcagtggctcgtgcgttcagctcaaagcctgccgccgcggatgttattgggatc
gatttgggaacgaccaactcgtgtgtctccgttatggaagggaagacaccacgagtgatt
gagaatgcggaaggcgcaaggacgacaccctccattgttgccaagaaccagaatggtgat
cttttggttggcataaccgcgagtcggcaggcagtgaccaatgcccagaacacggtccgt
gggtctaagcgcttgattggtagaacttttgatgacccacagactcagaaggaaatgaag
atggtgccttacaagattgtcaggggacctaatggtgatgcttgggtggagatgggtggg
cagcagtactccccaagccagattggtgcatttgttctcaccaagatgaaggaaactgca
gaggctttccttggcaaaactgtctccaaggctgttatcactgtcccagcttatttcaat
gatgctcagcgccaggctaccaaggatgctggtaggattgccgggctagaggtgatgagg
attatcaatgaacccactgccgcagctctgtcatatgggatgaacaacaaggagggtctg
attgctgtatttgacttgggtggtggcacatttgatgtatcaatccttgagatctccaat
ggagtttttgaggtcaaggcaaccaatggagatactttccttggtggtgaggactttgat
ggtgcattgcttgactacctggttagtgagtttaagaagtctgacaacattgatctgagc
aaggataagttggccttgcaaaggctcagggaagctgcagagaaggccaaggtcgagctt
tcctcaaccatgcagactgaaatcaacctcccctttattactgctgatgccactggtgca
aaacacttcaatattaccttgaccagatcaaagttcgagtctcttgtgcagtctctcatt
gagagaactcgcatcccctgtgtgaactgcctgaaggatgcaggcgtatctgcaaaagac
attgatgaggttctactggttggtggtatgacgagggtgccaaaggttcaggatattgtt
tctcagatattcaacaagacaccaagcaagggtgtcaatcctgatgaggctgttgccatg
ggagctgccattcagggtggcatcttgaggggtgatgtgaaggagctccttttgctggat
gtcactcccctctcccttggtattgagactcttggaggcatcttcacaaggctaattaat
cggaacacaaccattccaaccaagaagagtcaggtcttctccactgctgcagacaaccag
acccaggttggaatcaaggtgctccagggtgagagggagatggccacagacaacaagctt
cttggtgagttccagcttgaaggtattccaccagccccaagaggtatgcctcagattgag
gtcacattcgacatcgatgccaatggtattgtcaaggtgtcagccaaggacaagtccact
ggcaaagagcaagaaatcactataaagtcttcaggcggtttgtctgaaagtgatatcgag
aagatggtgagggaggctgagctacattctcagaaggatcaggaaaggaaatcattgatt
gatctgaagaactctgcagacaccacgatctacagcattgagaagagtgtcagtgagtac
aaggacaaggttcctgctgaagtcaccaatgagattcagtctgctgtatctgatctaaga
gcagcaatggctgaggatgatttggagaagatcaagcagaagcttgaggctgcaaacaag
gcagtttcaaagattggagagcacatgcaacaaggtggcggtggcggcagtggcggcggc
agcagcagcagcagtggtggtgaccagactcctgaggctgaataccaggatgctgctaag
gaagctaagatgtag

DBGET integrated database retrieval system