KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330890
Entry
4330890           CDS       T01015                                 
Name
(RefSeq) DNA-3-methyladenine glycosylase
  KO
K03652  DNA-3-methyladenine glycosylase [EC:3.2.2.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4330890
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4330890
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     4330890
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4330890
 Prokaryotic type
     4330890
SSDB
Motif
Pfam: Pur_DNA_glyco
Other DBs
NCBI-GeneID: 4330890
NCBI-ProteinID: XP_015624253
UniProt: Q0DX49 A0A0P0VQ44
LinkDB
Position
2:complement(32695342..32697587)
AA seq 286 aa
MKSLPSICTVHPHAHTPTPPPPPVAGGSRPSPMTTTTTSGAPTPPRFKRSPHRKKRQPRT
RRVAAGETIAAGKPPHPACTAVSLQSPFGPALPRDFFEVDALDLAPRLLGKLLRRDEVVL
RITEVEAYRPNDSACHGRFGITARTAPVFGSGGHAYVYLCYGLHMMLNVVADKEGVGAAV
LIRSCAPVSGLATIQQRRGQQTDKPLLLTGPGKVGQALGLSTDWSNHPLYTPGGLEVLDG
PEPENILVGPRVGIEYASPEHVAAPWRFAVAGTPWISAPKNTLRPR
NT seq 861 nt   +upstreamnt  +downstreamnt
atgaaatcccttccttccatctgcaccgtccatccccacgcacacacccccacgccaccg
ccgccgccggtcgccggagggagccggccatctccgatgaccaccaccaccacctccggg
gcgcccacgcccccacgcttcaagcgatccccccacaggaagaagcggcagccccgtacc
cgccgcgtcgccgccggagagaccatcgccgcggggaaaccaccgcacccggcgtgtacg
gcggtgtcgttgcagtcgccgtttgggcccgcattgccgcgcgatttcttcgaggtggac
gcgcttgacctcgccccacgcctcctcggcaagctgctgcgccgcgacgaagtcgtcctc
cgcatcaccgaggtggaggcttacaggccaaatgactccgcgtgccacggccggttcggc
atcacggcgaggactgctcctgtgtttggatcaggagggcatgcgtatgtttacctgtgc
tatggactgcacatgatgctcaatgtcgtcgctgacaaggagggagttggagctgctgtt
ctgattcggtcatgtgctcccgttagtgggctggcaactattcagcagcgtcgaggccag
cagactgataagccacttctactcactggaccaggaaaggttggtcaagctctggggctt
tccactgactggtccaaccatcctctgtacacacctggtgggttggaggtactagacggg
ccagaaccggagaacattttggttggcccccgtgtaggcatcgaatacgcatcgccggag
catgttgctgcaccatggaggttcgccgtcgcagggacgccatggattagtgcccccaag
aacactctcagaccaaggtga

DBGET integrated database retrieval system