KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330895
Entry
4330895           CDS       T01015                                 
Name
(RefSeq) replication factor C subunit 3
  KO
K10756  replication factor C subunit 3/5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4330895
   03420 Nucleotide excision repair
    4330895
   03430 Mismatch repair
    4330895
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4330895
   03036 Chromosome and associated proteins [BR:osa03036]
    4330895
   03400 DNA repair and recombination proteins [BR:osa03400]
    4330895
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    4330895
  DNA Replication Termination Factors
   ELG1-RFC complex
    4330895
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    4330895
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     4330895
  Check point factors
   HRAD17(Rad24)-RFC complex
    4330895
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 Rad17 AAA_11 AAA_assoc_2 AAA_22 AAA_16 AAA_5 AAA_30 ATPase_2 AAA_7 RuvB_N DUF815 AAA_14 AAA_19 AAA_24 AAA_18 bpMoxR DNA_pol3_delta ResIII AAA_3 TniB MCM ABC_tran TIP49 AAA_35 Mg_chelatase
Other DBs
NCBI-GeneID: 4330895
NCBI-ProteinID: XP_015627208
UniProt: Q6YZ54
LinkDB
Position
2:complement(32723404..32727553)
AA seq 361 aa
MAGATAATPMDIDAAAPPPGAAAKGKAPLSSTPGGRAAPWVEKYRPQSLGDVAAHRDIVD
TIDRLTNENRLPHLLLYGPPGTGKTSTILAVARKLYGSQYGNMILELNASDERGIDVVRQ
QIQDFASARSLSFGAKQSVKMVLLDEADAMTKDAQFALRRVIEKHTRSTRFALICNHVNK
IIPALQSRCTRFRFAPLDGTHVRERLKHIIQSEGLDVDDGGLTALVRLSNGDMRKALNIL
QSTHMASKQITEEAVYLCTGNPMPKDIEQIAYWLLNESFSTSFKCISDMKMRKGLALVDI
IREVTMFVFKIQMPSDVRIKLINDLADIEYRLSFACNDKLQLGALISTFTGARTAMVAAA
H
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggcgggagccaccgccgccactccgatggacatcgacgccgccgcgccgccgccgggg
gcggccgccaagggcaaggcgcctctctcctccactcccggcggtagggccgcgccctgg
gtcgagaagtaccgcccccaatccctcggcgatgtcgccgcccaccgcgacatcgtcgac
accattgataggcttacaaatgagaacaggcttccacatttgttgctttatgggcctccg
ggcactgggaaaacatcgacaatactggccgttgcaaggaagttgtatgggtcacagtat
ggcaacatgattcttgaactcaatgcatcagatgagcgtggtattgatgttgtaaggcag
caaatccaagacttcgcaagtgcccgcagtctctctttcggagcaaagcaatctgttaag
atggttctattggatgaagcagatgccatgaccaaggatgcacagtttgcattgcgaaga
gtcattgagaagcatacaaggagcacaaggtttgcgctgatatgcaaccatgtgaacaaa
atcattccagcactgcaatcaaggtgcaccaggtttagatttgcaccccttgatggcact
catgttagggaacgtcttaaacatataatacaatccgaggggcttgatgtagatgacggt
ggtttgacagcccttgtgcggttaagtaatggtgatatgaggaaggctttgaacatattg
cagtcaacacacatggcatctaagcaaataacagaggaagctgtgtacctttgcacagga
aaccccatgccgaaagacattgaacagatagcatactggttgctgaatgaatcattttca
accagcttcaaatgtatatctgatatgaagatgagaaaaggactggccttggttgatatc
atacgggaggtcactatgtttgtgttcaaaatacagatgccatctgatgtacgcataaag
ctgattaatgatctggctgatatcgagtaccggctaagctttgcttgcaatgacaagtta
cagctgggggcgctgatatcaactttcacgggtgctcgcacggctatggttgctgctgcc
cactaa

DBGET integrated database retrieval system