KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330902
Entry
4330902           CDS       T01015                                 
Name
(RefSeq) replication protein A 70 kDa DNA-binding subunit A
  KO
K07466  replication factor A1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4330902
   03420 Nucleotide excision repair
    4330902
   03430 Mismatch repair
    4330902
   03440 Homologous recombination
    4330902
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4330902
   03032 DNA replication proteins [BR:osa03032]
    4330902
   03400 DNA repair and recombination proteins [BR:osa03400]
    4330902
Transcription factors [BR:osa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    4330902
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    4330902
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     4330902
   MMR (mismatch excision repair)
     4330902
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     4330902
SSDB
Motif
Pfam: Rep_fac-A_C REPA_OB_2 Rep-A_N tRNA_anti-codon CDC24_OB3
Other DBs
NCBI-GeneID: 4330902
NCBI-ProteinID: XP_015625818
UniProt: Q6YZ49
LinkDB
Position
2:complement(32832938..32836475)
AA seq 656 aa
MAMARLTPNGVAAALAGDTNLKPVLQIVELRGVQVNGAGVTRGERFRAVVSDGTAASSAL
FAAQLSDHARSGALRRGSIVQLSEYVINEVGPRRIIVILNLEVLVSECEIIGNPTALSET
GSPIPNPTRVEQFNGAPQYGLMAGNSSNTTTKPSDNVPLFQNSMAGNSSNFATRPSDKVP
VFQPTVQPSYRPAPNYKNHGAIMKNEAPARIIPISALNPYQGRWAIKARVTAKGDIRRYH
NAKGDGKVFSFDLLDSDGGEIRVTCFNALLDRFYEVVEVGKVYVVSRGNLRPAQKNYNHL
NNEWEILLENGSTVDLCPDENSSIPTQRFDFRPINEIEDAQNNAILDIIGVVTSVNPCTT
IQRKNGMETQKRTMNLKDMSGRSVEVTMWGDFCNREGSQLQGMVERGIFPVLAVKAGKVS
DFSGKSVGTISSTQLFINPDSAEAHSLRQWFDSGGRDASTQSISRDITPGASRNEIRKTV
AQIKDEGLGMGDKPDWITVKATVIFFKNESFFYTACPNMIGDRQCNKKVTKSTNGNWTCD
KCDREFEECDYRYLLQFQIQDHSGTAWVTAFQEAGQELLGCSATELNALKEREDPRFADT
MLNCLFQEYLLRLKVKEESYGDERKVKNTAVKVEKVDPSGESKFLLDLISKSSALH
NT seq 1971 nt   +upstreamnt  +downstreamnt
atggcgatggcgaggctgacgccgaacggcgtggcggcggcgctggcgggggacacgaac
ctgaagccggtgctgcagatcgtcgagctgcggggcgtccaggtcaacggcgcgggcgtc
acgcgcggggagaggttccgggcggtggtctccgacggcaccgccgcgtcctccgcgctc
ttcgccgcgcagctcagcgaccacgcccgatccggcgccctccgacgcggcagcattgtg
cagctcagcgagtacgtcatcaacgaagtcggccccagaaggattattgtcattctgaac
ctggaagttcttgtttcggagtgtgagataattgggaatcctacagcgctttcagaaact
ggatctcctatcccaaatccgacaagagtagagcaatttaacggagcacctcaatatggt
ttgatggcagggaactcatcaaatacaaccacaaagcctagtgacaatgttccattgttc
caaaattcgatggcaggaaactcctctaactttgccactaggcccagtgacaaagttccg
gtcttccaaccaacagtccagccatcttatcgccctgcacctaattacaaaaaccatgga
gcaatcatgaaaaatgaagcccctgctagaataatccccatatctgctttaaatccttat
caaggccgctgggctatcaaggctagagttactgccaagggagatatccgccgataccat
aatgctaaaggtgatgggaaagtattctcttttgacttgcttgattctgatgggggagag
atacgggtgacatgcttcaatgctcttcttgatcgattctatgaagttgtggaagttggt
aaggtctatgtggtatcaagaggaaacttgagacctgcacagaagaactataaccatctt
aacaatgagtgggagattttattggagaatggatcaactgtggatctttgtcctgatgag
aacagttccattcccacccagcggtttgacttcagaccgatcaatgaaattgaggatgcc
cagaacaatgctatccttgacatcataggtgttgttacatcggtcaatccttgcaccaca
atacagaggaaaaatggcatggaaactcagaaaagaactatgaacctgaaggatatgtct
ggtcgaagtgttgaggtaaccatgtggggtgacttttgcaacagagaaggctcacagctt
caaggaatggttgaacgtgggatctttcctgtgctggctgtcaaagcaggaaaagtgagt
gatttcagtggcaagtctgtcggcacaatttcttcaactcagctcttcatcaaccctgat
tctgctgaagctcatagtctcaggcaatggtttgatagtggaggaagagatgcttctact
cagtccatatccagagatatcacgcctggagcatcaaggaatgagatccgaaagacagta
gcacagatcaaggatgaaggtcttggaatgggggacaaacctgactggattacggtgaaa
gccaccgttatattcttcaagaatgagtccttcttctacacagcttgccctaacatgatt
ggcgacaggcagtgcaataagaaggtgacaaagagtactaatggcaattggacctgtgac
aaatgcgatagggagtttgaagagtgcgactacaggtatctcctgcagtttcagattcaa
gatcactcgggaacagcttgggtgacagcattccaggaggctgggcaggagttgcttggc
tgctcggcaacagagctcaacgcacttaaggagcgcgaggaccctcggtttgcagacacc
atgctcaattgcttgtttcaggaatatctgctcaggctgaaggtcaaagaagaatcatac
ggcgatgagcgcaaagtgaagaacaccgcggtcaaagtggagaaggttgatccttcgggt
gaaagtaaatttctgctggatttgatctccaagtcctcggcgctacattag

DBGET integrated database retrieval system