KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331016
Entry
4331016           CDS       T01015                                 
Name
(RefSeq) DNA replication licensing factor MCM5
  KO
K02209  DNA replication licensing factor MCM5 [EC:5.6.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4331016
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4331016
   03036 Chromosome and associated proteins [BR:osa03036]
    4331016
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     4331016
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4331016
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     4331016
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N AAA_3 Mg_chelatase AAA_5 Sigma54_activat
Other DBs
NCBI-GeneID: 4331016
NCBI-ProteinID: XP_015623388
UniProt: Q6KAJ4
LinkDB
Position
2:complement(33936224..33940533)
AA seq 729 aa
MSGWDEGAVFYSDQAQFPRGGPGGDPSADLTRHSALRKFKEFLRGFTGPTGDFPYRESLV
HNRDHVTVAIEDLDAFDAELSDKIRKSPADYLPLFETAASEVLASLRSKVAGETGEMEEP
ATGDVQIFLSSKENCLSMRSIGADYMSKLVKIAGITIAASRVKAKATHVTLLCKNCRSVK
TVPCRPGLGGAIVPRSCDHVPQPGEEPCPLDPWIAVPDKSKYVDLQTLKLQENPEDVPTG
ELPRNMLLSVDRHLVQTIVPGTRLTVIGIYSVYQASANQKGAVGVKQPYIRVVGLEQSRD
ANSNGPSNFTLDEEMEFKEFAQRPDAYVKICSMIGPSIYGHSDVKKAIACLLFGGSKKRL
PDGVRLRGDIHVLLLGDPSTAKSQFLKFVEKTAPIAVYTSGKGSSAAGLTASVIRDGSSR
EFYLEGGAMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVL
AAANPIAGRYDDLKTAQDNIDLQTTILSRFDLIFIVKDVRMYDQDKRIASHIIKVHASGA
AASSKNTDASEGENWLKRYIEYCRVTCKPRLSEKAAEMLQNKYVEIRQKMRQQAHETGRA
AAIPITVRQLEAIIRLSESLAKMRLTSVATPEHVEEAFRLFNVSTVDAARSGINEHLNLS
PDIANEIKQAEAQIKRRMGIGSHISERRLIDELNRMGMNESIVRRALLIMHQRDEVEYKR
ERHVIVRKA
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgtcgggttgggacgagggcgccgtcttctacagcgaccaggcgcagttcccgcgcggc
ggccccggcggcgacccctccgccgacctcacccgccactccgccctccgcaagttcaag
gagttcctccgcggcttcaccggcccaaccggcgacttcccctaccgcgagagcctggtg
cacaaccgcgaccatgtcaccgtcgccatcgaggacctcgacgccttcgacgccgagctg
tccgacaagatccggaagtctcccgctgattacctaccgctgtttgagacggctgcgtcc
gaggtcctcgcgagccttcggtccaaggtcgctggagagaccggcgagatggaggagccc
gccaccggcgacgtgcagatcttcttgtcctcaaaggagaactgcctgtccatgaggtct
attggggcggattacatgtccaagctggtgaagattgccgggatcacaatcgccgcgtcg
agggtgaaagctaaggccactcatgtcacgctgctctgcaagaactgcagaagtgtgaaa
acggtgccgtgtaggcctggccttggtggggctattgtcccacgatcgtgcgaccatgtt
cctcagcctggagaagagccttgccccttggacccctggattgcagttccagataagagc
aagtatgtggatctccagaccctcaaattgcaggaaaatcctgaggatgttccaactggt
gagctcccgaggaatatgctgctgtccgtagacaggcatcttgttcagaccattgttcct
ggaactagattaactgtaattggtatctacagtgtctaccaagcatctgcaaaccaaaag
ggtgctgttggagtcaaacagccttacattagagttgtggggttggagcagtcccgagat
gccaactcgaatggtccctcaaattttacacttgatgaggaaatggaattcaaagaattt
gcacagaggccagatgcatatgtcaagatttgctcaatgattggcccttcaatttatggc
cattctgatgtcaagaaagctattgcatgcttgctgtttggtggctcaaagaagaggcta
ccggatggtgtccgtttgagaggggacattcatgtcttgctgctgggtgatccatcaaca
gcaaaatcacagttcctcaagtttgtggagaagacagcgccgattgctgtctatacatct
gggaaaggttcatcagcagctggtctcacagcgtcagtaattcgggacggtagctctcga
gagttttatttggaaggaggggccatggttttggctgatggtggagttgtttgtattgat
gagtttgacaaaatgaggcctgaggaccgagttgcaattcacgaagcaatggaacagcag
accatctcgattgccaaagctggcattacaacagtactcaattcaaggacctcggtacta
gcagctgccaatccaattgcagggcgctacgatgatcttaagactgcacaagataacatt
gatctgcagacaaccatcctttctagatttgatctaatctttattgttaaagatgtcaga
atgtatgatcaagacaagcgaattgcaagccacatcattaaggtgcatgccagtggtgct
gctgcttcatccaagaatacagatgctagtgaaggagagaattggctaaaaaggtacatt
gagtattgccgtgttacttgtaaaccacgactctcagaaaaggcagcagagatgcttcag
aacaaatatgtggagattagacagaaaatgagacaacaagctcatgaaacagggagggct
gcagctatacccatcactgtgcggcagcttgaagccattatacgtttgagtgaatctctt
gcaaagatgagattgacaagtgtggctacaccagagcatgttgaagaggcatttaggctg
ttcaatgtctccactgttgatgccgcaagatctggaatcaatgagcatttgaacctatca
ccagatattgcaaatgagatcaagcaagctgaggcacaaataaagagaaggatgggaatt
ggaagccacatatccgagcgacgcctgatcgatgaactaaataggatggggatgaatgaa
tccattgtgcgaagagcccttctgatcatgcaccaaagggatgaagtggagtacaagaga
gagcgccatgtcattgtccggaaggcttga

DBGET integrated database retrieval system