KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331049
Entry
4331049           CDS       T01015                                 
Name
(RefSeq) vesicle-associated membrane protein 711
  KO
K08515  vesicle-associated membrane protein 7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4331049
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4331049
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4331049
Membrane trafficking [BR:osa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    4331049
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4331049
SSDB
Motif
Pfam: Synaptobrevin Longin IgaA
Other DBs
NCBI-GeneID: 4331049
NCBI-ProteinID: XP_015625152
UniProt: Q69SJ1 A0A0N7KGA1
LinkDB
Position
2:34263957..34265819
AA seq 226 aa
MGRIQYAAVARGAVVMAEHGDAAFPNAGAVARQILDRLSAGDGGGGGDCNISYTQDLHVF
HVKRTDGVTALCMADDAAGRRIPFAFLEDIHGRFVKTYGRAALTALAYAMNDEFSRVLGQ
QMDYYSNDPNADRISRMRGEMDQVRNVMIDNIDKVLERGDRLELLVDKTATMQGNTMRFK
RQARRFRNTVWWRNVKLTAASVFILLVIIYIVLVYMCHGFTLPSCI
NT seq 681 nt   +upstreamnt  +downstreamnt
atggggaggatccagtacgcggcggtggcgaggggggcggtggtgatggcggagcacggc
gacgcggcgttccccaacgccggggccgtcgcgcggcagatcctcgaccgcctctccgcc
ggcgatggcggcggcggcggcgattgcaacatctcctacacgcaggatctccacgtgttc
cacgtcaagcgcaccgacggcgtcaccgcgctctgcatggccgacgacgccgccggacga
cggattcccttcgcgtttcttgaggatatccacggaaggtttgtcaagacgtatggtcgt
gctgctctcactgctcttgcttatgcgatgaatgatgagttctcgagggttttgggccaa
caaatggactactactcaaacgatcccaacgcagatagaatatctcggatgagaggtgaa
atggatcaggtccggaatgttatgatcgacaacattgacaaagtactcgagagaggtgat
cgtctggagctgttggtcgacaagactgcaactatgcaagggaacacgatgcgatttaaa
cgacaagctcgccgcttcagaaacaccgtctggtggagaaatgtcaagctcacagccgca
tcggtattcatccttcttgtaataatatacatagtgcttgtatatatgtgccacggcttc
accttaccgtcttgtatttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331733
Entry
4331733           CDS       T01015                                 
Name
(RefSeq) putative vesicle-associated membrane protein 726
  KO
K08515  vesicle-associated membrane protein 7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4331733
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4331733
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4331733
Membrane trafficking [BR:osa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    4331733
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4331733
SSDB
Motif
Pfam: Synaptobrevin Longin RNA_pol_RpbG DUF6267 HSCB_C LMBR1
Other DBs
NCBI-GeneID: 4331733
NCBI-ProteinID: XP_015630002
UniProt: Q10RB1 Q0DUV4
LinkDB
Position
3:3551768..3554415
AA seq 223 aa
MAPQKRTTLVYSFVARGAVVLADHAEVSGNFASVAAQCLQKLPSTNNRHSYNCDGHTFNY
HVHDGFTYCVVATESAGRQLPVGFIERVKEDFSKKYSGGKAKNATANSLKREYGPKLKEH
MKYCDAHPEEIDKLAKVKAQVTEVKGVMMQNIEKVLDRGEKIELLVDKTEDLRSQAQDFR
KAGTKIRRKMWWENMKMKLIVFGIVVALILVIILTVCRDLNCW
NT seq 672 nt   +upstreamnt  +downstreamnt
atggcgccgcagaagaggacgacgctggtctacagcttcgtggcgcgcggcgccgtcgtg
ctggccgaccacgccgaggtctccggcaacttcgcctccgtcgccgcgcagtgcctccag
aagctcccctccaccaacaaccgccacagctacaactgcgacggccacaccttcaactac
catgtccacgacggattcacatactgtgttgttgctaccgagtctgctggtcggcaactt
ccagttggcttcattgagagagtaaaggaagatttttccaagaaatatagtggaggaaaa
gcaaagaatgctaccgcgaatagcctcaagcgagaatatgggcctaaacttaaagaacac
atgaagtactgtgatgcgcaccctgaggagattgacaagcttgccaaagtgaaggctcag
gttacagaggtcaaaggagttatgatgcaaaacattgaaaaggttttagatcgtggtgag
aaaattgagctgcttgtcgacaagacagaggatctccgctcacaggcacaagactttaga
aaagcgggaacaaagattcggcgaaagatgtggtgggagaatatgaagatgaagctcatt
gttttcggcattgtagttgcattgatcctcgtcatcatcttgacggtttgccgtgacttg
aactgctggtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334472
Entry
4334472           CDS       T01015                                 
Name
(RefSeq) vesicle-associated membrane protein 721
  KO
K08515  vesicle-associated membrane protein 7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4334472
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4334472
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4334472
Membrane trafficking [BR:osa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    4334472
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4334472
SSDB
Motif
Pfam: Synaptobrevin Longin RNA_pol_RpbG Sigma_reg_N
Other DBs
NCBI-GeneID: 4334472
NCBI-ProteinID: XP_015632621
UniProt: Q84SZ1 B9F6J2
LinkDB
Position
3:33507179..33510365
AA seq 220 aa
MGQQSLIYAFVARGTVILAEYTEFTGNFTTIASQCLMKLPASNNKFTYNCDGHTFNYLVE
DGFTYCVVAVESVGRQIPIAFLDRVKDDFTKRYAGGKAATAAANSLNRDFGSKLKEHMQY
CVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQAG
TQVRRKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKCK
NT seq 663 nt   +upstreamnt  +downstreamnt
atggggcagcagtcgctgatctacgcgttcgtggcccgcggcacggtcatcctggccgag
tacacggagttcaccggcaacttcaccaccatcgcctcccagtgcctcatgaagctcccg
gcgagcaacaacaagttcacctacaactgcgacggccacacgttcaactacctcgtggag
gacggcttcacatactgtgtcgtagctgttgaatcagtagggcggcagattcccattgca
ttcttggatagagttaaggatgatttcacaaaaagatatgctggtggaaaagctgctact
gctgctgcgaacagcctcaaccgagattttggatcgaaacttaaagaacacatgcagtac
tgtgtggatcatcctgaagagattagcaagcttgcgaaagtgaaggcacaagtttcagaa
gtcaaaggagttatgatggaaaatattgagaaggttcttgatcgtggagagaaaattgaa
ctgctcgttgacaagaccgagaatctgcgttcacaggcccaagatttcaggcaggcagga
acacaggtaaggagaaagatgtggctgcaaaacatgaagatcaagctgattgttcttggc
ataataattgcgctcatccttatcataatcctgtccgtgtgccatggattcaaatgcaag
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340278
Entry
4340278           CDS       T01015                                 
Name
(RefSeq) vesicle-associated membrane protein 711
  KO
K08515  vesicle-associated membrane protein 7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4340278
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4340278
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4340278
Membrane trafficking [BR:osa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    4340278
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4340278
SSDB
Motif
Pfam: Synaptobrevin Longin Sigma_reg_N DUF6630
Other DBs
NCBI-GeneID: 4340278
NCBI-ProteinID: XP_015641118
UniProt: Q0DE63 Q9LWK1
LinkDB
Position
6:complement(3773666..3776566)
AA seq 221 aa
MAILYAVVARGTVVLAEHSAAATNAGAVARQVLERLPGGGADSHVSYTQDRYVFHAKRTD
GITALCMADEAAGRRIPFAFLEDIHGRFVKTYGRAALTSLAYGMNDEFSRVLSQQMDYYS
NDPNADRINRMRGEISQVRTVMIDNIDKVLERGDRLDMLVDKTANMQGNTIRFKRQARRF
RNTTWWRNVKLTIALIFLLTVIIYVVLVFMCHGFTLPTCIR
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcgatcctgtacgcggtggtggcgcgcgggacggtggtgctggcggagcacagcgcg
gcggcgaccaacgcgggcgccgtggcgcggcaggtcctcgagcgcctccccggcggggga
gccgacagccacgtctcctacacgcaggaccgctacgtcttccacgccaagcgcaccgac
ggcatcaccgcgctctgcatggccgacgaggccgccggacggcgaatcccctttgcgttc
cttgaggatatccatggaaggttcgtgaagacatatggccgtgctgcattgacatccctt
gcttatggcatgaatgatgagttctcgagggtcttgagtcagcaaatggattactattcg
aatgacccaaacgcagacagaataaatcgtatgaggggtgaaatcagtcaggtccgtact
gttatgattgacaatattgataaagtccttgaaagaggtgatcgtttggacatgttggtc
gacaagactgcaaatatgcaaggaaatacaattcgttttaaacgacaagctcgccgcttc
agaaataccacctggtggagaaatgttaaactcacgattgcgttgatattcctcctcacg
gtaataatatacgttgtgctcgtctttatgtgccatggcttcaccttgcctacttgtatt
aggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348130
Entry
4348130           CDS       T01015                                 
Name
(RefSeq) vesicle-associated membrane protein 714
  KO
K08515  vesicle-associated membrane protein 7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4348130
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4348130
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4348130
Membrane trafficking [BR:osa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    4348130
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4348130
SSDB
Motif
Pfam: Synaptobrevin Longin ABC_membrane DUF2721
Other DBs
NCBI-GeneID: 4348130
NCBI-ProteinID: XP_015614986
UniProt: A0A8J8XKM5 Q33B02
LinkDB
Position
10:complement(3358028..3360551)
AA seq 226 aa
MAIVYAVVARGTVVLAEFSAVSGNAGAVARRILEKLPPDAESRLCFAQDRYIFHVLRSPP
PAAADGLTFLCMANDTFGRRIPFLYLEDIQMRFIKNYGRIAHNALAYAMNDEFSRVLHQQ
MEYFSSNPSADTLNRLRGEVSEIHTVMVDNIEKILDRGERISLLVDKTSTMQDSAFHFRK
QSRRLRRALWMKNAKLLAVLTAVIVLLLYLIIAAFCGGLSLPSCRS
NT seq 681 nt   +upstreamnt  +downstreamnt
atggcgatcgtttacgcggtggtggcgcgtggcaccgtggttctcgccgagttctctgcc
gtctccgggaacgccggcgccgtcgcccgccgcatcctcgagaagcttccgcccgacgcc
gagtcgcgcctctgcttcgcgcaggaccgctacatcttccacgtcctccgctcccctccc
cccgccgccgccgatggcctcaccttcctctgcatggccaacgacaccttcggaagacga
attccctttctttacctcgaggacatccaaatgaggttcatcaagaactatggcagaatc
gcccataatgcgctcgcctatgccatgaacgatgagttctctagggtcctccatcagcaa
atggagtacttctccagcaaccccagcgccgacacactcaaccgtctccgtggggaagtc
agtgagatacatactgtcatggttgacaacattgagaagattctcgacagaggtgagcgc
atctcgctactcgtcgacaagacctccaccatgcaagacagtgctttccacttccgcaag
caatccaggaggctcaggagagctctttggatgaaaaatgccaagcttcttgctgtgttg
acagctgtcatagtacttctactttacttgatcatcgctgctttctgtggaggcctttct
cttccatcgtgtagatcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352920
Entry
4352920           CDS       T01015                                 
Name
(RefSeq) vesicle-associated membrane protein 721
  KO
K08515  vesicle-associated membrane protein 7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4352920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4352920
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4352920
Membrane trafficking [BR:osa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    4352920
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4352920
SSDB
Motif
Pfam: Synaptobrevin Longin EMP24_GP25L Glycophorin_A
Other DBs
NCBI-GeneID: 4352920
NCBI-ProteinID: XP_015619880
UniProt: A0A0P0YCQ1
LinkDB
Position
12:27438660..27441822
AA seq 219 aa
MAESKLIYAMVARGTVVLAEHTAYAGNFRDIAAQCLQKLPAGDNRLTYTCDAHTFNFLIH
QGYAYCVVATESSGRQIPLALLDMIKEDFNKRYAGGKAATAAANSLSRDFGPRLGEQMKY
CMDHPEEVSKLAKVKAQVSEVKGIMMENIDKAIDRGQQIDVLVSRTEQLHDQAADFRQQG
TRVRRKMWYQNMKIKLIVLGIIIALILIIILSVCHGFKC
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcggagtcgaagctgatatacgcgatggtggcgcgagggacggtggtgctggcggag
cacacggcgtacgccggcaacttccgggacatcgccgcgcagtgcctgcagaagctcccc
gccggcgacaaccgcctcacctacacctgcgacgcccacaccttcaacttcctcatccac
caaggctacgcatactgcgtggttgcaaccgagtcgagtggccggcagattcctctcgcc
ttgctagatatgatcaaggaggatttcaacaagaggtatgcaggaggaaaagcagccaca
gctgcagccaacagcctcagccgagatttcgggccaaggcttggagagcagatgaagtac
tgcatggatcaccctgaggaggtgagcaagctagccaaagtgaaagctcaggtctctgaa
gttaaaggcatcatgatggaaaacattgacaaggccattgatcgcggacagcagatcgac
gtacttgtcagcaggacagagcaactccatgaccaggctgctgatttcaggcagcaaggg
acgcgagtgcggcgcaagatgtggtaccagaacatgaagatcaaactcatcgtcctcggt
atcatcatcgcgctcatcctcatcataatcctctccgtttgccacggcttcaaatgctag

DBGET integrated database retrieval system