KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331050
Entry
4331050           CDS       T01015                                 
Name
(RefSeq) 26S protease regulatory subunit 6A homolog
  KO
K03065  26S proteasome regulatory subunit T5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4331050
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4331050
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     4331050
SSDB
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_5 AAA_16 AAA_2 RuvB_N AAA_22 DUF815 AAA_7 AAA_14 Mg_chelatase AAA_33 AAA_24 PhoH TIP49 ATPase AAA_11 AAA_18 IstB_IS21 Sigma54_activat RNA_helicase AAA_3 AAA_25
Other DBs
NCBI-GeneID: 4331050
NCBI-ProteinID: XP_015625151
UniProt: P46465
LinkDB
Position
2:complement(34266066..34269936)
AA seq 429 aa
MSSPPPAAAAAMAVDDADDDQLASMSTEDIVRATRLLDNETRVLKDELQRTNLEVESYKE
KIKENQEKIKLNKQLPYLVGNIVEILEMNPEDEAEEDGANIDLDSQRKGKCVVLKTSTRQ
TIFLPVIGLVDPEKLKPGDLVGVNKDSYLILDTLPSEYDSRVKAMEVDEKPTEDYNDIGG
LEKQIQELVEAIVLPMTHKDRFQKLGIRPPKGVLLYGPPGTGKTLMARACAAQTNATFLK
LAGPQLVQMFIGDGAKLVRDAFQLAKEKSPCIIFIDEIDAIGTKRFDSEVSGDREVQRTM
LELLNQLDGFSSDERIKVIAATNRADILDPALMRSGRLDRKIEFPHPSEEARARILQIHS
RKMNVNPDVNFEELARSTDDFNGAQLKAVCVEAGMLALRRDATEVTHEDFNEGIIQVQAK
KKSSLNYYA
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgtcgtcgccgccgcccgccgccgccgccgcgatggccgtcgacgacgccgacgacgac
cagctcgcctccatgtccacggaggacatcgtcagggcaacccgcctcctcgacaacgag
acccgcgtcctcaaggatgagctgcagcggacgaaccttgaggtggaatcctacaaggag
aagatcaaggagaaccaggagaagatcaaactcaacaagcagctgccttaccttgtcggc
aacatcgtcgagatattggaaatgaaccccgaggatgaggctgaagaggatggtgcgaac
atcgatctggattcacaaaggaaaggaaaatgcgttgttttgaagacatccacaagacaa
acaatattccttcctgtaatcgggcttgttgaccctgaaaagctcaagcctggggatttg
gttggagtcaacaaagacagctacttgatactagacacgctaccttcagaatatgattca
cgggttaaggcaatggaggtagatgaaaagcctacagaggattacaatgacattggtggc
cttgagaaacagattcaagagcttgttgaagcaatagtattgcccatgactcacaaggac
cggtttcagaagttgggaattcgccccccgaaaggtgttcttttgtacggaccacctggc
actggaaagaccctaatggctcgtgcatgtgctgcccaaactaacgccacatttctgaaa
cttgctggtccacagcttgtccagatgttcatcggtgatggtgcaaagcttgtccgtgat
gcctttcagcttgcaaaggagaaatccccctgcatcatttttattgatgaaattgacgca
attggaacaaagcgttttgatagtgaagttagtggtgacagagaagtgcagcgcacaatg
ttggagttgctgaatcagctagatggattcagtagtgacgagaggataaaggtgatagct
gcaactaatcgcgcggacattcttgatcctgctttgatgaggtctggtaggctggaccga
aaaattgagttccctcatccatccgaagaagcacgagctagaattttgcaaatccattca
agaaaaatgaatgtaaaccctgatgtcaactttgaagagttggcacgatctacggacgac
ttcaatggtgcacaactgaaggccgtttgtgtagaagcaggcatgcttgccctacgccga
gatgctacagaggtgacacacgaggatttcaatgaagggatcatacaagtgcaagccaaa
aagaagtccagtttaaattattacgcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335380
Entry
4335380           CDS       T01015                                 
Name
(RefSeq) 26S protease regulatory subunit 6A homolog
  KO
K03065  26S proteasome regulatory subunit T5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4335380
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4335380
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     4335380
SSDB
Motif
Pfam: AAA AAA_lid_3 AAA_16 AAA_5 DUF815 RuvB_N AAA_22 AAA_2 AAA_7 ATPase AAA_18 AAA_24 Mg_chelatase IstB_IS21 AAA_14 TniB RNA_helicase Sigma54_activat AAA_33 AAA_3 AFG1_ATPase AAA_11 Prot_ATP_ID_OB TMF_TATA_bd AAA_25 AAA_19 Sigma54_activ_2
Other DBs
NCBI-GeneID: 4335380
NCBI-ProteinID: XP_015634335
UniProt: Q7XW77 B9FE88
LinkDB
Position
4:complement(12252018..12258690)
AA seq 357 aa
MPSSAAAAADGGDIEEVDRLKKRIRTLEMEETKLNQHMERVIQGIEANEAYLVGMVLRIM
EKGPEDETAEDDCDVGFHLQRKIIFRPIAGVVYPSKLKPGDLIGVDSTSNEHYCGIGGLE
KQIEELVEAVVLPIIHKNCFQRLGIHPPKGVLLYGPPGTGKTLVAHAFASQTNATFLKLT
GPQLAVKLIGEGARLVRDAFQLAKEKAPCIIFIDEIDAIGSKHFDSGDREVQQTIVELLN
QLDGVGSYESIKVIAATNRPEVLDPAFLRSGRLDQKIEFPHPSEQARVRILEIHSRKMDK
NPDVNFEELACCTDDFNGAQLKAVCFEASMLAFHRDATEVRHEDFVRAIAQVKDGNY
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgccttcctccgccgcagccgccgccgacggcggcgacatcgaggaggtggaccgcctc
aagaagaggatcaggaccctcgagatggaggagacgaagttgaaccagcatatggaacgc
gtcatccagggaatcgaagcgaacgaggcgtacctcgtcggcatggtcctcaggattatg
gaaaagggcccagaggatgagactgctgaggatgattgtgatgttggctttcatttgcag
cgaaaaattatattccgtcctattgctggggtagtgtaccctagcaaacttaagcctgga
gatttaattggtgttgacagtacatcaaatgaacactactgtggcattggtggtctcgaa
aaacaaattgaggagcttgtggaagcagttgtgttgccaataatccacaagaactgcttc
cagaggttgggaattcaccctccaaaaggtgtacttctgtatggaccacctggaactggg
aagacactcgttgcccatgcatttgcttcccagacaaatgcaacatttcttaagctaact
ggtccacaacttgccgtgaagcttattggtgagggagcaagacttgttcgtgatgccttt
cagcttgctaaagagaaagccccatgcattattttcattgatgaaattgatgcaattgga
agcaagcactttgatagtggtgatagggaagtgcaacaaacaattgtggagcttcttaat
cagttggatggcgtcgggagctatgagagtataaaggtaatagctgcaactaatcggcca
gaagttcttgatcctgcttttctgcgatctggccgtttagatcaaaagattgaattccct
catccatctgaacaggctagagttagaattctggagatccactcccgaaaaatggacaaa
aaccctgatgtaaactttgaagagttggcttgctgtacagatgattttaatggtgcacag
ctaaaggctgtatgctttgaggctagcatgctggcatttcaccgagatgctacagaggtt
cggcatgaggactttgtcagagcaattgcgcaagtaaaagacgggaattactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340276
Entry
4340276           CDS       T01015                                 
Name
(RefSeq) 26S protease regulatory subunit 6A homolog
  KO
K03065  26S proteasome regulatory subunit T5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4340276
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4340276
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     4340276
SSDB
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_5 AAA_2 AAA_16 RuvB_N AAA_22 DUF815 AAA_7 Mg_chelatase AAA_33 PhoH AAA_24 AAA_14 ATPase AAA_11 AAA_18 TIP49 IstB_IS21 Sigma54_activat AAA_19 RNA_helicase AAA_25 AAA_3
Other DBs
NCBI-GeneID: 4340276
NCBI-ProteinID: XP_015641102
UniProt: A0A0P0WTN1 Q5SNC0
LinkDB
Position
6:3689667..3694347
AA seq 429 aa
MTSSGAPPPAAMAVDDAEDDQLASMSTEDIVRASRLLDNEIRVLKDELQRTNLELESFKE
KIKENQEKIKLNKQLPYLVGNIVEILEMNPEDEAEEDGANIDLDSQRKGKCVVLKTSTRQ
TIFLPVVGLVDPDKLKPGDLVGVNKDSYLILDTLPSEYDSRVKAMEVDEKPTEDYNDIGG
LEKQIQELVEAIVLPMTHKDRFQKLGIRPPKGVLLYGPPGTGKTLMARACAAQTNATFLK
LAGPQLVQMFIGDGAKLVRDAFQLAKEKAPCIIFIDEIDAIGTKRFDSEVSGDREVQRTM
LELLNQLDGFSSDERIKVIAATNRADILDPALMRSGRLDRKIEFPHPSEEARARILQIHS
RKMNVNPDVNFEELARSTDDFNGAQLKAVCVEAGMLALRRDATEVTHEDFNEGIIQVQAK
KKSSLNYYA
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgacgtcatccggcgctcccccgccggcggcgatggccgtggacgacgcggaggacgac
cagctcgcctccatgtccacggaggacatcgtccgtgcctcccgcctactcgacaacgag
atccgcgtcctcaaggatgagctgcagcggaccaacttggagctggaatcgttcaaggag
aagattaaggagaaccaggagaagattaagctcaacaagcagcttccctacctcgtcggc
aacatcgttgagattctggaaatgaaccctgaggatgaagctgaggaggatggtgctaat
attgatttagactcacaaaggaaaggaaaatgtgttgttctgaagacttccacaagacaa
actatattccttcctgtggttgggctagttgaccctgataaactcaagcctggtgatttg
gttggagtaaacaaagacagctaccttatactggacacactgccatcagagtatgattca
cgagtaaaggcaatggaggtggatgaaaaacccacagaggactacaatgatattggaggt
cttgaaaagcagattcaagagcttgtggaggcaattgttttgccaatgacacacaaagat
cggttccaaaagttgggcattcgcccccccaaaggagttcttttgtatggaccacctgga
actgggaagacattgatggctcgtgcatgtgctgcacagacaaatgcgacgttcctgaaa
ttagctggtccacaattagtccagatgtttatcggtgatggagcaaagctggttcgggat
gcttttcagcttgctaaggagaaagctccctgcatcattttcattgatgagattgatgcc
attgggactaagaggtttgacagtgaggttagtggtgacagagaagttcagaggactatg
ttggaattgctgaaccaactcgatggatttagtagtgacgagcggataaaggtcatagcg
gcaacgaatcgtgctgacattcttgatcctgctttgatgcgatctggtcgtttggaccga
aagattgagtttcctcatccatctgaagaagcaagagctagaatcttgcaaattcactca
agaaaaatgaatgtaaacccagatgtgaattttgaagagctggctcgctcaacagatgac
ttcaatggagcgcaactgaaagctgtttgtgtcgaagctggtatgcttgcactgcggcga
gatgctacagaggtgactcatgaggacttcaacgaaggcataatacaggtgcaggctaag
aagaagtctagcctaaattattacgcttaa

DBGET integrated database retrieval system