KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331069
Entry
4331069           CDS       T01015                                 
Name
(RefSeq) mRNA-decapping enzyme subunit 2
  KO
K12613  mRNA-decapping enzyme subunit 2 [EC:3.6.1.62]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4331069
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4331069
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.62  5'-(N7-methylguanosine 5'-triphospho)-[mRNA] hydrolase
     4331069
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4331069
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     4331069
SSDB
Motif
Pfam: DCP2 NUDIX
Other DBs
NCBI-GeneID: 4331069
NCBI-ProteinID: XP_015625652
UniProt: Q6K8F6 Q6K837
LinkDB
Position
2:complement(34378689..34382102)
AA seq 323 aa
MAMAGGGGLNRSSSRGQLPPQELLDDLCSRFVLNVPKEDLESFERILFLLEQAHWFYEDN
SVEHNPSLKSLSFKDFTTLMFNSCAALRPYRAHLDDIYKDFTHYKFRVPVCGAIILDDTY
EKCLLVKGWKSSASWSFPRGKRSKDEEDHTCAVREVLEETGCDVSKLLKLEDYIEVSMWQ
QRVRLYIITGVKGDTVFAPQTKKEISEISWHNIDELLPAGDDAISRGVNGMKLYMVAPFL
QGLKAWIATHRHPQYQKSDTSARGTVWKAKNSSTGAAPVENPVITRTGSDPQTLDSRPGK
SFRNFRFDTASILQSMEASFLRT
NT seq 972 nt   +upstreamnt  +downstreamnt
atggcgatggcgggcggcggggggctcaaccggtcgtcgtcgagggggcagctgccgccg
caggagcttctcgacgatctctgcagccgcttcgtgctcaacgtgcccaaggaggatttg
gagtcgttcgagcggatcctgttcttgctggagcaggcgcactggttctacgaggacaac
tccgtcgagcacaacccctccctcaagtcgctctccttcaaggacttcactacgctcatg
ttcaatagctgtgctgcgctcaggccataccgcgcgcaccttgatgacatttacaaggat
ttcactcactataagttccgtgtccctgtctgcggcgccatcatcctcgatgacacctac
gagaagtgcttgcttgtgaagggatggaagtctagcgccagctggagttttcctcgtgga
aagaggagtaaagatgaagaagatcatacatgtgctgttagagaagttctagaggaaact
gggtgtgatgtttcgaagcttttaaaattggaagattatattgaagtttcaatgtggcag
caaagagtccgcctttatattataactggtgttaagggggatactgtttttgcgcctcaa
actaagaaggagatcagtgagatctcatggcacaacatcgatgaactccttcctgctggt
gatgacgcaatatctcgtggagtgaatgggatgaagctctatatggtcgcaccatttttg
cagggtctaaaagcctggatagccacacatcgtcacccacagtatcagaaatcagacacg
tctgctagaggtactgtgtggaaagcgaagaattcctcaactggagcggcgcctgttgag
aaccccgttattactagaacaggatctgacccacaaactcttgacagccgcccaggtaaa
agcttccgaaacttcaggttcgacacagcgagtatcctgcagtccatggaagcttccttc
ctacgtacctag

DBGET integrated database retrieval system