KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331112
Entry
4331112           CDS       T01015                                 
Name
(RefSeq) glutathione reductase, cytosolic
  KO
K00383  glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4331112
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     4331112
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 HI0933_like GIDA Lys_Orn_oxgnase NAD_binding_9
Other DBs
NCBI-GeneID: 4331112
NCBI-ProteinID: XP_015626808
UniProt: P48642
LinkDB
Position
2:34837744..34843836
AA seq 496 aa
MARKMLKDEEVEVAVTDGGSYDYDLFVIGAGSGGVRGSRTSASFGAKVAICELPFHPISS
DWQGGHGGTCVIRGCVPKKILVYGSSFRGEFEDAKNFGWEINGDINFNWKRLLENKTQEI
VRLNGVYQRILGNSGVTMIEGAGSLVDAHTVEVTKPDGSKQRYTAKHILIATGSRAQRVN
IPGKELAITSDEALSLEELPKRAVILGGGYIAVEFASIWKGMGAHVDLFYRKELPLRGFD
DEMRTVVASNLEGRGIRLHPGTNLSELSKTADGIKVVTDKGEEIIADVVLFATGRTPNSQ
RLNLEAAGVEVDNIGAIKVDDYSRTSVPNIWAVGDVTNRINLTPVALMEATCFSKTVFGG
QPTKPDYRDVPCAVFSIPPLSVVGLSEQQALEEAKSDVLVYTSSFNPMKNSISKRQEKTV
MKLVVDSETDKVLGASMCGPDAPEIIQGMAVALKCGATKATFDSTVGIHPSAAEEFVTMR
TLTRRVSPSSKPKTNL
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggctaggaagatgctcaaggacgaggaggtggaggtggccgtcaccgacggcgggagc
tacgactacgacctgttcgtgatcggcgccgggagcggcggcgtccggggctctcgcacc
tccgcgtccttcggggctaaggttgcgatttgcgagctcccgttccatcccatcagctcg
gattggcaaggagggcatggtgggacgtgtgtgatacgtggttgtgtgcctaaaaagata
ctggtgtatggttcatctttccgcggagaatttgaggatgcaaagaattttgggtgggaa
atcaatggggacattaacttcaactggaaaaggctgctggaaaataagactcaagaaatt
gttagactaaatggagtataccagaggattcttggcaattctggtgtgacaatgattgaa
ggggcaggcagtttggttgatgctcatacagttgaagtcacaaagccagatggttcaaag
caaagatatacagcaaagcacatattgatagcaactggtagccgagctcaacgtgtcaac
attcctgggaaggagttagctattacttcagatgaggccttaagtttggaggagctacca
aaacgtgctgtaatccttggtggcggatatattgctgttgaatttgcttctatatggaaa
gggatgggtgcgcacgtagacttgttttatcgaaaagagcttcctctaagaggtttcgat
gatgagatgaggacggttgttgcaagtaaccttgagggaaggggaatcagattacatcca
gggacaaatctatctgagttgagtaaaacagccgatggcataaaagttgtcactgacaaa
ggagaggagatcattgcagatgttgttctgtttgctacaggtcgcacaccaaactcccag
aggttgaacttggaagctgctggtgttgaagttgataatattggagctataaaggttgat
gattattctcgtacatcagtcccaaatatatgggctgtgggtgatgtaacgaaccggata
aatttaacacctgttgcactgatggaggctacctgcttttctaaaactgtgtttggtggc
cagccaactaaacctgattacagagatgtaccttgtgctgttttctccatcccaccacta
tcagtagtgggcttgagtgaacagcaggctttggaggaagccaagagcgatgttcttgtt
tacacttccagcttcaacccaatgaagaacagcatatccaaacggcaggagaagaccgtc
atgaaactggtggttgattcagagactgataaagtacttggtgcatcaatgtgtggacca
gatgcaccagagattatccagggtatggctgtagcgctgaagtgtggagccaccaaggcg
acctttgacagcactgttggtattcacccgtctgctgctgaagagtttgtgacaatgcgg
accttgaccaggcgcgtgagcccatcatccaagccaaagacaaacttgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331719
Entry
4331719           CDS       T01015                                 
Name
(RefSeq) glutathione reductase, chloroplastic
  KO
K00383  glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4331719
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     4331719
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 Lys_Orn_oxgnase HI0933_like
Other DBs
NCBI-GeneID: 4331719
NCBI-ProteinID: XP_015627860
UniProt: Q8S5T1 Q7G6Z6
LinkDB
Position
3:3427529..3432249
AA seq 555 aa
MATTATLPFSCSSTLQTLTRTIPLRLRLHRRRFLHHLPSLAALPRLPLPRPPLLPHARRH
VSASAAPNGASSEGEYDYDLFTIGAGSGGVRASRFASTLYGARAAVCEMPFATVASDDLG
GVGGTCVLRGCVPKKLLVYGSKYSHEFEESHGFGWVYETDPKHDWNTLIANKNTELQRLV
GIYKNILNNSGVTLIEGRGKIVDPHTVSVDGKLYTARNILIAVGGRPSMPNIPGIEHVID
SDAALDLPSKPEKIAIVGGGYIALEFAGIFNGLKSEVHVFIRQKKVLRGFDEEVRDFIAE
QMSLRGITFHTEQSPQAITKSNDGLLSLKTNKETIGGFSHVMFATGRKPNTKNLGLEEVG
VKLDKNGAIMVDEYSRTSVDSIWAVGDVTDRVNLTPVALMEGGAFAKTVFGDEPTKPDYR
AVPSAVFSQPPIGQVGLTEEQAIEEYGDVDIYTANFRPLRATLSGLPDRIFMKLIVCATT
NKVVGVHMCGEDAPEIIQGVAIAVKAGLTKQDFDATIGIHPTSAEEFVTMRNATRKVRRS
TTDEVESKDKVVTQN
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggcgacgaccgcgaccctccccttctcctgctcctccaccctccaaaccctaacccgc
accatccccctccgcctccgcctccaccgccgccgcttcctccaccacctcccctccctc
gctgccctcccgaggctcccgctcccgcgacctcccctcctcccccacgcgcgccgccac
gtctcggcgtccgcggcgcccaacggcgcgtcctccgagggggagtacgactacgacctc
ttcaccatcggcgccgggagcggcggggtccgggcctcgcgcttcgcctccacgctctac
ggcgcccgcgccgccgtctgcgagatgcccttcgccaccgtcgcctcggacgacctcggt
ggagtcggcggcacatgtgtgcttcgtgggtgtgttccaaagaaattattagtgtatgga
tccaagtactctcatgagtttgaagagtctcatggctttgggtgggtgtatgaaactgat
ccaaagcatgactggaacactctgattgccaacaaaaatacagagctgcagcgccttgtt
ggcatttacaagaatattttaaacaactcaggagttactctaattgaaggccgtggaaag
atagttgatccacatactgtaagtgtagatggaaagctctacactgctaggaacatactt
atagctgttggtgggcgaccatcgatgccaaatatcccaggaatagagcatgttatagat
tctgatgctgcactggatctaccttcaaaacctgagaaaattgcaatagtgggaggtgga
tatattgctctggagtttgctggaattttcaatggcttaaaaagtgaggtacatgtgttt
attcggcagaagaaagttttaagagggtttgatgaagaggtcagagatttcatcgctgaa
cagatgtctctaaggggcatcacatttcatactgaacagagtcctcaagctataaccaaa
tcaaatgatggtttgctatctctgaagacaaacaaagaaactattggtgggttctcacat
gttatgttcgcaacaggtcgtaaaccaaacacaaagaaccttggactagaggaggttggg
gtgaaattggacaagaacggagcaataatggttgatgagtattctcgaacctcagttgat
tcaatttgggcagtgggagatgttactgatagggtcaacctgacaccagttgcacttatg
gaaggtggtgcatttgcaaaaacagtgtttggtgatgaacctaccaaaccagattacaga
gctgtaccatctgccgttttctcccaaccacccatcggacaagttggtcttactgaagag
caggctattgaggagtatggagatgttgatatctatacagcaaacttcaggccacttagg
gcaactctctctggattacctgatcgcattttcatgaaactcattgtgtgtgctacaaca
aacaaagttgtaggagtacacatgtgtggtgaagacgcacctgagataattcagggagtt
gcaattgctgttaaagctgggctgacaaagcaagattttgatgccactattggcattcac
ccaacatctgcagaggaatttgtcacaatgagaaatgcaactagaaaagttcggagaagc
acaacagatgaggtagaatctaaagataaggttgttactcagaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348623
Entry
4348623           CDS       T01015                                 
Name
(RefSeq) glutathione reductase, chloroplastic
  KO
K00383  glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4348623
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     4348623
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 Lys_Orn_oxgnase
Other DBs
NCBI-GeneID: 4348623
NCBI-ProteinID: XP_015613132
UniProt: B9G5R2
LinkDB
Position
10:complement(14505503..14510025)
AA seq 566 aa
MATAATLPSSSSSAAAAVQTISRVLSFPRRGGGGFLHLRRHPLAAAAAATRGRGPLLRLG
PRRPFSASASAGDNGAAAGGDGGGCDYDYDLFTIGAGSGGMRASRVAASLYGARAAVCEM
PFATVASDSLGGVGGTCVLRGCVPKKLLVYASKYSHEFEESHGFGWRYGTEPKHDWSTLM
TNKNLELQRLVGVQTNMLKNSGVTIIEGRGKVVDPHTVSVDGKLYTAKNILIAVGGRPSM
PDIPGIEHVIDSDAALDLPSRPEKIAIVGGGYIALEFAGIFNGLKSGVHVFIRQKKVLRG
FDEEVRDFVADQMSLRGITFHTEETPQAVMKSDDGLLTLTTNKGSINGFSHVMFATGRKP
NTKNLGLEEVGVKMDKHGAIVVDEFSRTSVDSIWAVGDVTNRVNLTPVALMEGGALARTI
FGNEPTKPDYSAVPSAVFSQPPIGQVGLTEEKAIEKYGDVDVYTSNFRPLRATLSGLPDR
VYMKVIVCANTNKVLGVHVCGEDAPEIIQGIAIAVKAGLMKQNFDATIGVHPTTAEELVT
MRSPTRKVRRDAVDEAKMKDEATSQK
NT seq 1701 nt   +upstreamnt  +downstreamnt
atggcgacggcggcgaccctcccctcctcctcctcctccgccgccgccgcggtccagacc
atatcccgcgtcctctccttcccccgccgcggcggcgggggcttcctccacctccgccgc
caccccctcgcggctgcggctgccgccacccggggccggggcccgctcctccgcctcggc
ccgcgccgcccgttctccgcctccgcctccgccggggataacggggccgctgcgggcggc
gatgggggtgggtgcgactacgactacgacctcttcaccatcggcgccgggagcggcggg
atgcgggcgtcgcgcgtcgccgcctccctctacggcgcccgcgccgccgtctgcgagatg
cccttcgccaccgtcgcgtccgacagcctcggcggcgtcggcggaacatgtgtgcttcgt
ggctgtgtcccaaagaaactgctggtgtatgcatccaaatactctcatgagtttgaagag
agtcatggctttgggtggaggtatggcactgagccaaagcatgactggagcactctgatg
accaacaagaatttagagttgcagcgcttggtgggggttcagacaaacatgctaaagaat
tctggggtcactataattgaaggccgtggaaaggttgttgatccacatactgtcagtgtt
gatggaaagctttatactgcaaaaaacatactcattgcagttggtggtcggccatccatg
ccagacattccagggatagagcatgttattgattcagatgcagcattggacctgccttca
agacctgagaagattgcgatagtaggaggagggtatattgctttggagtttgctggcatt
ttcaatggcttaaaaagtggtgttcatgttttcatccgacagaagaaagtactgagaggc
tttgatgaggaggtcagggattttgttgccgatcagatgtctttgaggggtatcacattt
cataccgaagagactcctcaagcagtaatgaaatcagacgatggcttgctgactctgacg
acaaacaaaggaagcataaatgggttctcacatgtaatgtttgcaacaggacgaaaacca
aatacaaagaatttgggtctagaagaggttggggtcaaaatggacaagcatggtgctatt
gtggttgatgagttctctcgaacctcagttgattctatatgggctgtgggtgatgttact
aacagggtgaacttgacaccggttgcattaatggaaggtggggcattagcaaggactatt
tttggcaatgaacctacaaaaccagattacagtgctgtgccatctgcggtgttttcccaa
cctccaattggacaagttggactcactgaagagaaggcgatcgaaaagtatggagatgtt
gatgtctacacatcaaacttcagacctctcagggccactctttctggtctacctgatcgt
gtatacatgaaggttatcgtgtgtgctaatactaacaaagttctaggagtgcacgtgtgt
ggtgaagatgcacccgagattattcagggtattgcaattgctgtaaaggctgggttgatg
aagcaaaactttgatgccaccataggtgtccacccaaccactgcagaagaacttgtcaca
atgagaagcccgactaggaaggtccggagagatgctgtggatgaggccaaaatgaaagat
gaggccacaagtcagaagtag

DBGET integrated database retrieval system