KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331133
Entry
4331133           CDS       T01015                                 
Name
(RefSeq) exosome complex component csl4
  KO
K07573  exosome complex component CSL4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4331133
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4331133
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     4331133
 Prokaryotic type
  Archeal mRNA degradation factors
   Exosome components
    Core exosome
     4331133
SSDB
Motif
Pfam: EXOSC1 ECR1_N CHASE5
Other DBs
NCBI-GeneID: 4331133
NCBI-ProteinID: XP_015626600
UniProt: Q0DWG8 A0A0P0VR39
LinkDB
Position
2:complement(34941294..34944098)
AA seq 197 aa
MAATAMDHDGGEVVTPGELLGNSSLLAGLGAYADGRCVRASITGHRRLVPPPPGSTDQRS
TVEVVGHKAHGAVPQPGSVVIARVTKVMARMASADIMCVDSKAVKEKFTGMIRQQDVRAT
EIDKVDMFQSYRPGDIVRALVLSLGDARAYYLSTAQNELGVVSAQSITGGTLVPISWTEM
QCELTGQIEQRKVAKVE
NT seq 594 nt   +upstreamnt  +downstreamnt
atggcggccacggcgatggaccacgacggcggcgaggtggtcacccctggggagctcctc
ggcaactcgtccctcctagcggggctcggcgcctacgccgacggccgctgcgtgcgcgcg
tccatcactggccatcgccgcctcgtgccgcctcctcccggctccaccgatcagaggtcc
acggtggaggtggtcgggcacaaggcccatggagctgtgccgcagccgggaagcgtcgtc
attgcgcgtgtgacgaaggttatggctaggatggcttctgcagatataatgtgtgttgac
tcaaaggctgtcaaggaaaagttcactggcatgataaggcagcaagatgttcgtgcaact
gaaatcgacaaggtggatatgtttcagtcataccgacctggtgatattgtcagagccctg
gttctctctcttggtgatgcaagggcatattacctttccactgcccagaatgaactcgga
gttgtttctgcacaaagtataactggtggtacactagtcccgatcagttggactgagatg
caatgcgaattgacgggccaaatagagcaaaggaaagttgcaaaagtggaatag

DBGET integrated database retrieval system