KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331252
Entry
4331252           CDS       T01015                                 
Name
(RefSeq) sucrose synthase 6
  KO
K00695  sucrose synthase [EC:2.4.1.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4331252
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4331252
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.13  sucrose synthase
     4331252
Glycosyltransferases [BR:osa01003]
 Others
  Other glycosyltransferases
   4331252
SSDB
Motif
Pfam: Sucrose_synth Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_1_2
Other DBs
NCBI-GeneID: 4331252
NCBI-ProteinID: XP_015626470
LinkDB
Position
2:35755105..35761459
AA seq 857 aa
MAVGLRRSDSIADMMPEALRQSRYQMKRCFQRYVSQGKRLMKRQQLLDELDKSVDDKADK
DQLLQGFLGYVISSTQEAAVLPPFVAFAVRMNPGIWEFVKVHSANLSVEQMTPSDYLKNK
EALVDDKWGAYDDDSQLEVDFGALDLSTPHLTLPSSIGKGAHLVSRFMSSKLTDNKKPLL
DYLLALSHRGDKLMINDILDTVDKLQTALLLAEVYVAGLHPDTNYSEFEQKFQEWGLEKG
WGDTAETCKETLSSLSEVLQAPDPINMEKFFSTVPCVFTVVIFSIHGYFGQEKVLGMPDT
GGQVVYILDQVRALEDELLQRIKQQGLNATPKILVLTRLIPEAKGTKCNVELEPIENTKH
SNILRVPFKTEDGKVLPQWVSRFDIYPYLERYAQDSSVKILEILEGKPDLVIGNYTDGNL
VASLLTSKLGVTQGTIAHALEKTKYEDSDIKWRELDHKYHFSCQFTADMIAMNTSDFIIA
STYQEIAGSKEKPGQYESHYAFTMPGLCRYATGINVFDPKFNIAAPGADQSVYFPFTQKQ
KRLTDLHPQIEELLYSKEDNNEHIGHLADRSKPIIFSMARLDKIKNITGLVEWYGQNKRL
RDLVNLVIVGGLLDPSQSKDREEIEEINKMHSLINKYQLVGQIRWIKGQTDRVRNGELYR
CIADTKGAFVQPALYEAFGLTVIEAMNCGLPTFATNQGGPAEIIVDEVSGFHINPLNGKE
ASDKIADFFQKCKEDLIYWSKMSTAGLQRIYECYTWQIYATKVLNMASIYGFWRTLDKEE
RQAKQHYLHMFYNLQFRKLAKNVPTLGEQPAQPTESAEPNRIIPRPKERRTQIRIQRIAT
NLLGPLLPASNFSTDGA
NT seq 2574 nt   +upstreamnt  +downstreamnt
atggccgtcgggttgaggagatcggacagcattgccgacatgatgccggaggcactgcgg
cagagccggtaccagatgaagaggtgcttccagaggtacgtgtcccagggtaagaggctc
atgaagaggcagcagctcttggacgagctcgacaaatccgtcgatgataaggccgacaag
gaccagctcctccagggcttccttggctacgtcatatcctccacacaggaggctgcagtg
ctccccccattcgtcgcattcgctgtcaggatgaaccctggcatctgggagttcgtcaag
gtccattccgcaaatctgtccgtcgagcagatgacaccgtcggactacctcaagaacaaa
gaggccctggttgatgacaaatggggggcttacgatgacgactcccagctggaagtcgat
tttggcgccctggacctgtcgacgcctcacctcacgctgccctcctccatcggcaaaggc
gcgcacttggtctccagattcatgtcttccaagctgaccgacaacaagaagccattgctg
gactacctgctggcgctcagccaccgcggcgacaagctgatgatcaacgacatccttgac
accgtcgacaagcttcagacagcactgcttctcgccgaggtttacgtcgccggcctgcat
cccgacacaaactactccgaatttgagcagaagtttcaggagtggggactggagaaaggc
tggggtgacactgctgaaacatgcaaagaaacactaagcagtctctcggaggtgctccaa
gcaccggatcccatcaacatggaaaagttcttcagtacggtgccctgcgtgttcaccgtt
gtcatcttctccatccatggttactttggccaggagaaggtcctcggtatgccagacacc
ggtggtcaggttgtctacatcctggaccaagttagagctctggaagacgaactgctgcaa
agaatcaagcagcagggcctgaatgccacacctaagattctcgtgctaacaaggctcata
ccagaagcaaagggcaccaaatgcaatgtagagttggaaccgattgaaaacacaaagcac
tccaacatcctccgtgtgccattcaagactgaggatggcaaagttcttccacagtgggtc
tcccggtttgacatctatccttacctggagagatatgcccaggattcttcagtcaagatt
ctcgaaatattggaggggaaaccagacttggtcattggcaattacaccgacggtaatcta
gtagcatccctcctgacaagcaaactaggagtcactcagggaacaatagcgcatgctcta
gagaagacgaagtacgaggattcagacatcaagtggagagaattggaccacaagtaccat
ttctcatgccagtttactgctgacatgattgccatgaacactagtgacttcatcatcgct
agtacctaccaagaaatagctggaagcaaagagaagcctggccagtatgagagtcactat
gcattcactatgccagggctctgccgctatgccacaggcatcaacgtatttgatcccaag
ttcaacattgctgcaccaggtgcagatcaatctgtttactttccctttacacaaaagcag
aagcgcctgactgacttacacccccaaattgaggagttgctctatagcaaagaggacaat
aatgagcatatagggcacctagcagacaggagtaagccaatcatcttttcaatggcaaga
cttgacaagataaagaacatcacagggctggtcgaatggtatggtcagaacaagaggctc
agggaccttgtgaaccttgtcattgttgggggcctcctggacccttcacagtcaaaggac
cgtgaggagatagaggagataaacaagatgcacagcctgataaacaagtaccagctcgtg
ggacagatccgttggataaaaggacagactgaccgagtgcgcaatggggaactttaccgt
tgcatcgcggacaccaagggagcctttgttcagcctgcactttatgaagcattcggacta
acagtcatcgaggcaatgaactgcgggctgcccacctttgcaacaaatcaaggaggacct
gcagagatcattgtcgatgaggtttcgggtttccatatcaacccgctcaatggcaaggag
gcaagcgacaagattgctgacttctttcagaaatgcaaggaagacctcatctactggagc
aagatgtccaccgctggactccaacgcatctatgagtgttacacgtggcagatctatgca
accaaagttctgaacatggcatcaatatatggcttctggaggactctagacaaggaagaa
agacaagctaaacagcactacctacacatgttctataatcttcaatttaggaagttggca
aagaatgtgccaacactgggcgaacaaccagcacaacctacagagagcgcagagcctaat
aggatcataccaagacccaaagaaagaaggacgcaaataaggatccagaggattgcaacc
aacttacttggaccactgctcccagcctccaatttctcaacagatggagcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332788
Entry
4332788           CDS       T01015                                 
Name
(RefSeq) sucrose synthase 4
  KO
K00695  sucrose synthase [EC:2.4.1.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4332788
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4332788
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.13  sucrose synthase
     4332788
Glycosyltransferases [BR:osa01003]
 Others
  Other glycosyltransferases
   4332788
SSDB
Motif
Pfam: Sucrose_synth Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_1_2
Other DBs
NCBI-GeneID: 4332788
NCBI-ProteinID: XP_015632177
UniProt: Q10LP5 K4FDV3
LinkDB
Position
3:complement(12674482..12680670)
AA seq 809 aa
MSGPKLDRTPSIRDRVEDTLHAHRNELVALLSKYVSQGKGILQPHHILDALDEVQSSGGR
ALVEGPFLDVLRSAQEAIVLPPFVAIAVRPRPGVWEYVRVNVHELSVEQLTVSEYLRFKE
ELVDGQYNDPYILELDFEPFNASVPRPNRSSSIGNGVQFLNRHLSSIMFRNKDCLEPLLD
FLRGHRHKGHVMMLNDRIQSLGRLQSVLTKAEEHLSKLPADTPYSQFAYKFQEWGLEKGW
GDTAGYVLEMIHLLLDVLQAPDPSTLETFLGRIPMIFNVVVVSPHGYFGQANVLGLPDTG
GQIVYILDQVRALENEMVLRLKKQGLDFTPKILIVTRLIPEAKGTSCNQRLERISGTQHT
YILRVPFRNENGILRKWISRFDVWPYLEKFAEDAAGEIAAELQGTPDFIIGNYSDGNLVA
SLLSYKMGITQCNIAHALEKTKYPDSDIYWTKYDEKYHFSCQFTADIIAMNNADFIITST
YQEIAGSKNTVGQYESHTAFTLPGLYRIVHGIDVFDPKFNIVSPGADMSIYFPYTEKAKR
LTSLHGSLENLISDPEQNDEHIGHLDDRSKPILFSMARLDRVKNITGLVEAYAKNARLRE
LVNLVVVAGYNDVKKSKDREEIAEIEKMHELIKTYNLFGQFRWISAQTNRARNGELYRYI
ADTHGAFVQPAFYEAFGLTVVEAMTCGLPTFATVHGGPAEIIEHGISGFHIDPYHPDQAA
NLIADFFEQCKQDPNHWVEVSNRGLQRIYEKYTWKIYSERLMTLAGVYGFWKYVSKLERR
ETRRYLEMFYILKFRELAKTVPLAVDEAH
NT seq 2430 nt   +upstreamnt  +downstreamnt
atgtcgggccccaagctcgaccgcaccccgagcatccgcgaccgcgtcgaggacaccctc
cacgcccaccgcaacgagctcgtcgccctcctctccaagtacgtgagccaggggaagggg
atcctgcagccgcaccacatcctcgacgcgctcgacgaggtccagagctccggcggccgc
gccctcgtcgagggccccttcctcgacgtcctccgctccgcccaggaggcgatcgtgctg
ccgccgttcgtggcgatcgcggtgcggccgcggccaggggtgtgggagtacgtccgcgtg
aacgtgcacgagctcagcgtcgagcagctcaccgtgtcggagtacctccgcttcaaggag
gagctcgtcgacggccagtacaacgatccgtacatacttgagcttgattttgagccattc
aatgcctcggttccacgcccaaatcggtcatcatcaattggaaatggcgtgcagtttctc
aacaggcacttgtcttcgatcatgttccggaacaaggattgcctggagcccctacttgat
ttccttcgtgggcatcggcataagggtcatgtcatgatgctaaatgacaggatacagagt
ctgggaagacttcagtctgtgctgacaaaagctgaggagcacttgtcgaaactcccagct
gacacaccatactcacagttcgcatataagtttcaagaatggggattggagaagggttgg
ggcgacacagctggatatgtcttggagatgatacatctccttctggatgtgcttcaagcg
cctgatccatctactcttgagacgttcttgggaaggatccccatgatctttaatgtcgtc
gtagtgtctcctcatggatattttggccaagccaatgtgttgggcttaccagatactgga
gggcagattgtctatatactggaccaagtccgtgcattggagaatgagatggttcttagg
ttaaagaaacaaggccttgattttacccctaaaattcttattgttactcggctgatacca
gaagcaaaagggacatcatgcaatcagcgtcttgagagaataagtgggacacaacatact
tacatattacgagtgccattcagaaatgaaaatgggatactcaggaaatggatatcaaga
tttgatgtatggccctacctggagaaatttgcagaggatgctgctggtgagattgctgca
gaactacaaggtactccagacttcataattggaaactacagtgacggtaatcttgttgca
tcattgctatcttacaagatgggaattacccagtgcaatattgctcatgctttggaaaag
actaaatatccagactcagacatatactggacgaagtacgatgagaagtaccatttctcc
tgtcagttcacagctgatataatcgccatgaacaatgctgattttataatcaccagcaca
taccaggaaattgctggcagcaaaaacacagttggacagtatgagagccatactgcattt
actcttcctggtctgtatcgtattgtccatgggattgatgtttttgacccaaagttcaac
atagtctctccaggagcagacatgtctatatactttccgtacactgaaaaggccaagcgg
ctcacttcgcttcatggttcacttgaaaacttgatttctgacccagagcaaaatgacgaa
catattggacacctggatgacagatcaaaacccattctcttttccatggcaagacttgac
cgagttaagaacataacagggttggttgaagcttatgctaaaaacgctaggctgagggag
ctggtaaaccttgtcgtggttgctggctataacgatgtcaagaaatccaaggacagagaa
gaaatcgcagagattgagaagatgcatgaacttattaagacctataacttgtttgggcag
ttccgttggatctcggctcagacgaacagggctcgcaatggtgagctctatcgctacata
gctgatactcatggtgccttcgtgcagccagctttctacgaagcattcggtctcactgtt
gtggaggccatgacatgtggactccctacttttgcaacagtccatggtggacctgccgag
attatagagcacgggatctcagggttccacatagatccttatcatccggatcaagctgca
aatctgatagctgacttcttcgaacaatgtaaacaagaccccaaccattgggttgaagtt
tctaatagaggcctacaacgtatatatgagaaatatacatggaagatctactctgagagg
ttgatgacattggctggggtttatggcttctggaagtatgtctcgaagcttgagaggcgg
gagaccaggcgctatcttgagatgttctacatattgaagttccgtgaactggcgaagact
gtacctcttgcagtagatgaggcacactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333062
Entry
4333062           CDS       T01015                                 
Name
(RefSeq) sucrose synthase 1
  KO
K00695  sucrose synthase [EC:2.4.1.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4333062
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4333062
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.13  sucrose synthase
     4333062
Glycosyltransferases [BR:osa01003]
 Others
  Other glycosyltransferases
   4333062
SSDB
Motif
Pfam: Sucrose_synth Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_1_2
Other DBs
NCBI-GeneID: 4333062
NCBI-ProteinID: XP_015629843
UniProt: P31924
LinkDB
Position
3:complement(16301346..16307688)
AA seq 816 aa
MGEAAGDRVLSRLHSVRERIGDSLSAHPNELVAVFTRLVNLGKGMLQAHQIIAEYNNAIS
EADREKLKDGAFEDVLRSAQEGIVISPWVALAIRPRPGVWEYVRVNVSELAVELLTVPEY
LQFKEQLVEEGTNNNFVLELDFEPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESM
YPLLNFLRAHNYKGMTMMLNDRIRSLSALQGALRKAEEHLSGLSADTPYSEFHHRFQELG
LEKGWGDCAKRSQETIHLLLDLLEAPDPSTLEKFLGTIPMVFNVVIMSPHGYFAQANVLG
YPDTGGQVVYILDQVRAMENEMLLRIKQQGLNITPRILIVTRLLPDATGTTCGQRLEKVL
GTEHTHILRVPFRTENGIVRKWISRFEVWPYLETFTDDVAHEIAGELQANPDLIIGNYSD
GNLVACLLAHKMGVTHCTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTTDLIAMNHADF
IITSTFQEIAGNKDTVGQYESHMAFTMPGLYRVVHGIDVFDPKFNIVSPGADMSIYFPYS
ESRKRLTSLHPEIEELLYSEVDNNEHKFMLKDRNKPIIFSMARLDRVKNLTGLVELYGRN
PRLQELVNLVVVCGDHGNPSKDKEEQAEFKKMFDLIEQYNLNGHIRWISAQMNRVRNGEL
YRYICDTKGAFVQPAFYEAFGLTVVESMTCGLPTFATAYGGPAEIIVNGVSGFHIDPYQG
DKASALLVEFFEKCQEDPSHWTKISQGGLQRIEEKYTWKLYSERLMTLTGVYGFWKYVSN
LERRETRRYLEMLYALKYRTMASTVPLAVEGEPSNK
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgggggaagctgccggcgaccgcgtcctgagccgcctccacagcgtcagggagcgcatc
ggcgactccctctccgcccaccccaatgagctcgtcgccgtcttcaccaggctggttaac
ctcggaaagggaatgcttcaggcccaccagatcattgctgagtacaacaacgcaatctct
gaggctgatcgtgagaagctgaaggacggtgcttttgaggatgtcctgaggagtgcacag
gaggggattgttatctccccatgggttgcccttgccatccgcccgaggcccggtgtctgg
gagtatgtgagggtcaatgtgagcgagctcgctgttgagttgctgacagtccccgagtac
ttgcagttcaaggaacagcttgtggaagaaggcaccaacaacaactttgtgcttgagctg
gatttcgagccattcaatgcctccttccctcgtccttctctgtcgaagtccattggcaat
ggtgtgcagttcctcaacaggcatctgtcatcgaagctcttccatgacaaggagagcatg
tacccactgctcaacttccttcgtgcacacaactacaagggcatgaccatgatgttgaat
gacagaatccgcagtctcagtgctctccaaggtgctctgaggaaggctgaggagcatctt
tctggtctttcagcagacaccccttactcagaattccaccacaggttccaggaacttggt
ctggagaagggttggggtgactgtgccaagcgttcccaggagaccattcacctccttttg
gaccttcttgaggcccctgatccgtccaccctcgagaagttccttggaacaatcccaatg
gtgttcaatgttgtcattatgtccccacacggttacttcgcgcaagccaatgtcttgggt
taccctgacactggagggcaggttgtctacattttggaccaagtccgtgctatggagaat
gagatgcttctgaggatcaagcagcaaggtctcaatattacaccacgcatccttattgtc
accaggttgctccctgatgcaactggcaccacctgcggtcagcgtcttgagaaggtcctt
ggcaccgagcacacccacatcctacgtgtgcctttcagaactgaaaatggaattgttcgc
aagtggatctcacgttttgaagtctggccgtacctggaaacattcactgatgatgtcgcg
cacgaaattgctggagagctccaggccaatcctgacttgatcatcggaaactacagtgac
ggaaaccttgttgcatgcttgcttgcacacaagatgggtgttacccattgtaccattgcc
catgcgcttgagaaaaccaagtaccccaactctgacctctactggaagaagtttgaggat
cactaccacttctcatgccagttcacaactgacttgattgcgatgaaccacgctgacttc
atcatcaccagtaccttccaagagattgccggaaacaaggacactgttggtcagtatgag
tctcacatggcattcaccatgcctggtctgtaccgtgttgtccacggtattgatgttttt
gacccgaagtttaacattgtctcgcctggtgcggacatgtccatctacttcccttactct
gagtctcgtaagaggctcacctccctccacccagagattgaggagttgctctacagcgaa
gttgacaacaacgagcacaagtttatgctgaaggacaggaacaagccaatcatcttctcc
atggctcgtcttgaccgtgtcaagaacttgactggtctggttgagctgtatggtcgcaac
cctcgcctgcaagagctggttaaccttgtggttgtctgtggtgaccatggcaacccatct
aaggacaaggaggagcaggctgagttcaagaagatgtttgaccttattgagcaatacaac
ttgaatggccacatccgctggatctccgcgcagatgaaccgtgtccgcaacggtgagctc
taccgttacatctgcgacaccaagggtgcttttgtgcagcccgctttctacgaggcattc
ggtctcactgttgttgagtccatgacctgtggtctcccgacattcgcaaccgcctatggt
ggtccagctgagatcatcgtgaacggagtgtctggcttccacattgacccataccagggt
gacaaggcctcggcgctgctcgttgagttctttgagaagtgccaggaagaccccagccac
tggaccaagatctcgcagggcggtcttcagcgtatcgaggagaaatacacctggaagctc
tactctgagaggctgatgaccctcaccggcgtctacggattctggaagtacgtctcgaac
ctggagaggcgtgaaacccgccgctaccttgagatgctgtatgccctcaagtaccgcacc
atggctagcaccgtcccgttggccgtcgagggcgagccgtcgaacaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335303
Entry
4335303           CDS       T01015                                 
Name
(RefSeq) sucrose synthase 7
  KO
K00695  sucrose synthase [EC:2.4.1.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4335303
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4335303
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.13  sucrose synthase
     4335303
Glycosyltransferases [BR:osa01003]
 Others
  Other glycosyltransferases
   4335303
SSDB
Motif
Pfam: Sucrose_synth Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_1_2 Fur_reg_FbpB TC1
Other DBs
NCBI-GeneID: 4335303
NCBI-ProteinID: XP_015634274
UniProt: Q7XNX6
LinkDB
Position
4:complement(9661933..9667157)
AA seq 855 aa
MASKLSFKRMDSIAETMPDALRQSRYQMKRCFQRYVSKGKRLLKNQQLMEELEKSLDDKV
ENEKLVEGFLGYIICSTQEAVVLPPFVAFAVRMNPGIWEYVKVHSDDLSVEGITPSEYLK
FKETLYDEKWAKDDNSLEVDFGALDLSTPHLTLPSSIGNGLQFVSKFMSSKLGGKPESMK
PLLDYLLTLNYRGEKLMINDTIDTVSKLQTALLLAEVFVSGLPKYTPYLKFEQRFQEWGL
EKGWGDTAERCKETLNCLSEVLQAPDPTNMEKFFSRVPSIFNIVIFSIHGYFGQEKVLGL
PDTGGQVVYILDQVRAMEEELLQRIKQQGLHVTPKILVLTRLIPDAKGTKCNVELEPVEN
TKYSHILRVPFKTEDGKDLRQWVSRFDIYPYLERYAQNSCAKILDILEGKPDLIIGNYTD
GNLVASLLSNKLCVTQGTIAHALEKTKYEDSDVKWREMDQKYHFSCQFTADMISMNTSDF
IITSTYQEIAGSKEKPGQYEHHYAFTMPGLCRYATGINVFDPKFNIAAPGADQSIYFPFT
QKQKRLTDLHPQIDELLYSKDDTDEHIGYLADRNKPIIFSMARLDKVKNITGLVEWYGQN
KKLRDLVNLVVVAGLLDASQSKDREEIEEINKMHNLMDRYQLKGQIRWIKAQTDRVRNGE
LYRCIADTKGAFVQPALYEAFGLTVIEAMNCGLPTFATNQGGPAEIIIDGVSGFHVNPIN
GREAGIKIADFFQKCKEDPSYWNKVSTAGLQRIYECYTWKIYATRVLNMGSTYSFWKTLN
KEERQAKQRYLQIFYNVQYRNLAKAVARAGDQQARQTTTGVAPSEIVVRPKERKPQTRMQ
RILTRLAGQKPPVSE
NT seq 2568 nt   +upstreamnt  +downstreamnt
atggcatccaagctgagtttcaagcgaatggacagcattgccgagacaatgccagatgcc
ctacgacaaagccggtaccagatgaagagatgcttccaaaggtatgtatcaaagggtaag
aggctcttgaagaaccagcagctcatggaagagctggaaaagtcactagatgacaaagtt
gagaacgagaagcttgtcgaaggctttctcggttacatcatttgttcgacacaggaagca
gtagtactcccaccgtttgtggcattcgctgtcagaatgaatcctggtatctgggagtac
gtcaaagttcactctgatgatctttctgtcgaaggaatcacaccgtcggagtatctcaag
ttcaaggagaccttatacgatgaaaaatgggccaaggatgacaactcactggaagttgat
ttcggtgcccttgacctctcaacaccccatttgacactgccctcgtcaatagggaatggg
cttcagtttgtctccaaattcatgtcctcaaagctgggtggcaaacctgaaagcatgaag
cctctgttggactatttacttaccttgaattaccgtggcgagaagttgatgattaatgac
accatcgacactgtgagcaagcttcagacagcactgctacttgcagaggttttcgttagt
gggctgccaaaatacacgccttacttgaagtttgaacaaagatttcaggagtgggggtta
gagaagggatggggtgacactgcggagaggtgcaaagaaacactaaattgtctgtctgaa
gtgctacaggcaccagatcctacaaacatggagaagttcttcagcagggttccatccata
ttcaacattgtcatcttctctattcatggttacttcggccaagaaaaggttcttggattg
ccggataccggtggtcaggttgtctacatattggatcaagtcagagccatggaagaggag
ctgcttcaaagaatcaagcagcagggtctgcacgtaacaccgaagattcttgtgcttaca
agactgataccagatgccaaaggcacaaaatgcaatgtggagcttgaaccagttgaaaat
acaaaatactcacatatactacgtgtgccattcaagactgaagatggcaaggatttgcgc
cagtgggtgtcccggtttgacatctatccttatctagagagatatgcgcagaactcttgt
gccaaaattctcgacattttggagggcaaaccggacttgataattggcaactacaccgat
ggcaacttggtggcatccctcttgtctaacaaactatgtgtcactcagggaacaattgca
cacgctctggagaagacaaagtacgaggattcagatgttaagtggagagagatggaccag
aagtaccatttctcttgccaatttaccgccgatatgatttccatgaacaccagcgacttc
atcatcactagcacttaccaagaaattgctgggagcaaagagaagcctggccaatatgag
caccactacgcattcacaatgccgggactatgccgctacgccacaggcattaatgtattc
gacccaaagttcaacattgctgcgcctggtgcagaccagtccatctacttccccttcacg
cagaagcagaagcggctgacagatttacacccacagatagacgaactgctgtacagcaag
gatgacactgatgaacacatagggtatctggcagacaggaacaaaccaatcatcttctcg
atggcaaggcttgataaggtaaaaaacataactgggcttgtggagtggtatggccagaac
aagaagctgagggacctcgtcaatctcgtcgtcgtcgcggggctcctggatgcttcgcag
tccaaggatcgagaggagatcgaggagataaacaagatgcacaacctgatggacaggtac
cagctcaaaggacagatccgctggatcaaggcacagactgaccgtgtccgcaacggtgag
ctgtaccgttgcattgcagatacaaagggtgcatttgttcagcctgcactgtatgaagca
ttcgggctaacggtcatcgaggcgatgaactgcgggttgccaaccttcgcaacgaaccag
ggcggaccagctgagataatcatcgacggtgtctctggtttccacgtaaaccccatcaac
ggcagggaggcaggaatcaagattgcagatttcttccagaaatgcaaggaagacccaagt
tactggaacaaggtgtccactgctgggcttcagcggatctacgagtgctacacatggaag
atttatgcaactagagtgctaaacatgggatctacatattccttctggaagacactaaac
aaggaggaaagacaagccaaacaacgttacctgcagatattctacaatgttcagtatagg
aacctggcaaaggctgtggcaagagcaggggatcaacaggctcggcaaaccacaacaggc
gtggcgcctagtgagatcgtagttagacccaaagaaagaaagccgcagactcggatgcaa
aggatcttaaccaggttagccgggcagaagcctccagtttctgagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335447
Entry
4335447           CDS       T01015                                 
Name
(RefSeq) sucrose synthase 5 isoform X1
  KO
K00695  sucrose synthase [EC:2.4.1.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4335447
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4335447
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.13  sucrose synthase
     4335447
Glycosyltransferases [BR:osa01003]
 Others
  Other glycosyltransferases
   4335447
SSDB
Motif
Pfam: Sucrose_synth Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_1_2 Fur_reg_FbpB TC1 Glycogen_syn
Other DBs
NCBI-GeneID: 4335447
NCBI-ProteinID: XP_015634172
UniProt: H6TFZ4
LinkDB
Position
4:14008210..14013444
AA seq 855 aa
MASKLSFKRMDSIAETMPDALRQSRYQMKRCFQRYVSKGKRLLKNQQLMEELEKSLDDKV
EKEKLVEGFLGYIICSTQEAVVLPPFVAFAVRMNPGIWEYVKVHSDDLSVEGITPSEYLK
FKETLYDEKWAKDDNSLEVDFGALDLSTPHLTLPSSIGNGLQFVSKFMSSKLGGKPESMK
PLLDYLLTLNYRGEKLMINDTIDTVSKLQTALLLAEVFVSGLPKYTPYLKFEQRFQEWGL
ERGWGDTAERCKETLNCLSEVLQAPDPTNMEKFFSRVPSIFNIVIFSIHGYFGQEKVLGL
PDTGGQVVYILDQVRAMEEELLQRIKQQGLHVTPKILVLTRLIPDAKGTKCNVELEPVEN
TKYSHILRVPFKTEDGKDLRQWVSRFDIYPYLERYAQDSCAKILDILEGKPDLIIGNYTD
GNLVASLLSNKLCVTQGTIAHALEKTKYEDSDVKWREMDQKYHFSCQFTADMISMNTSDF
IITSTYQEIAGSKEKPGQYEHHYAFTMPGLCRYATGINVFDPKFNIAAPGADQSIYFPFT
QKQKRLTDLHPQIDELLYSKDDTDEHIGYLADRNKPIIFSMARLDKVKNITGLVEWYGQN
KKLRDLVNLVVVAGLLDASQSKDREEIEEINKMHNLMDRYQLKGQIRWIKAQTDRVRNGE
LYRCIADTKGAFVQPALYEAFGLTVIEAMNCGLPTFATNQGGPAEIIIDGVSGFHVNPIN
DREAGIKIADFFQKCKEDPSYWNKVSTAGLQRICECYTWKIYATRVLNMGSTYSFWKTLN
KEERQAKQRYLQIFYNVQYRNLAKAMARAGDQQARQTTTGVAPSEIVVRPKERKPQTRMQ
RILTRLAGQKPPVSE
NT seq 2568 nt   +upstreamnt  +downstreamnt
atggcatccaagctgagtttcaagcgaatggacagcattgccgagacaatgccagatgcc
ctacgacaaagccggtaccagatgaagagatgcttccaaaggtacgtatcaaagggtaag
aggctcttgaagaaccagcagctcatggaagagctggaaaagtcactagatgacaaagtt
gagaaggagaagcttgtcgaaggctttctcggttacatcatttgttcgacacaggaagca
gtagtactcccaccgtttgtggcattcgctgtcagaatgaatcctggtatctgggagtac
gtcaaagttcactctgatgatctttctgtcgaaggaatcacaccgtcggagtatctcaag
ttcaaggagaccttatacgatgaaaaatgggccaaggatgacaactcactggaagttgat
ttcggtgcccttgacctctcaacaccccatttgacactgccctcgtcaatagggaatggg
cttcagtttgtctccaaattcatgtcctcaaagctgggtggcaaacctgaaagcatgaag
cctctgttggactatttacttaccttgaattaccgtggcgagaagttgatgattaatgac
accatcgacactgtgagcaagcttcagacagcactgctacttgcagaggttttcgttagt
gggctgccaaaatacacgccttacttgaagtttgaacaaagatttcaggagtgggggtta
gagaggggatggggtgacactgcggagaggtgcaaagaaacactaaattgtctgtctgaa
gtgctacaggcaccagatcctacaaacatggagaagttcttcagcagggttccatccata
ttcaacattgtcatcttctctattcatggttacttcggccaagaaaaggttcttggattg
ccggataccggtggtcaggttgtctacatattggatcaagtcagagccatggaagaggag
ctgcttcaaagaatcaagcagcagggtctgcacgtaacaccgaaaattcttgtgcttaca
agactgataccagatgccaaaggcacaaaatgcaatgtggagcttgaaccagttgaaaat
acaaaatactcacatatactacgtgtgccattcaagactgaagatggcaaggatttgcgc
cagtgggtgtcccggtttgacatctatccttatctagagagatatgcgcaggactcttgt
gccaaaattctcgacattttggagggcaaaccggacttgataattggcaactacaccgat
ggcaacttggtggcatccctcttgtctaacaaactatgtgtcactcagggaacaattgca
cacgctctggagaagacaaagtacgaggattcagatgttaagtggagagagatggaccag
aagtaccatttctcttgccaatttaccgccgatatgatttccatgaacaccagcgacttc
atcatcactagcacttaccaagaaattgctgggagcaaagagaagcctggccaatatgag
caccactacgcattcacaatgccgggactatgccgctacgccacaggcattaatgtattc
gacccaaagttcaacattgctgcacctggtgcagaccagtccatctacttccccttcacg
cagaagcagaagcggctgacagatttacacccacagatagacgaactgctgtacagcaag
gatgacactgatgaacacatagggtatctggcagacaggaacaaaccaatcatcttctcg
atggcaaggcttgataaggtaaaaaacataactgggcttgtggagtggtatggccagaac
aagaagctgagggacctcgtcaatctcgtcgtcgtcgcggggctcctggatgcttcgcag
tccaaggatcgagaggagatcgaggagataaacaagatgcacaacctgatggacaggtac
cagctcaaaggacagatccgctggatcaaggcacagactgaccgtgtccgcaacggtgag
ctgtaccgttgcattgcagatacaaagggtgcatttgttcagcctgcactgtatgaagca
ttcgggctaacggtcatcgaggcgatgaactgcgggttgccaaccttcgcaacgaaccag
ggcggaccagctgagataatcatcgacggtgtctctggtttccacgtaaaccccatcaac
gacagggaggcaggaatcaagattgcagatttcttccagaaatgcaaggaagacccaagt
tactggaacaaggtgtccactgctgggcttcagcggatctgcgagtgctacacatggaag
atttatgcaactagagtgctaaacatgggatctacatattccttctggaagacactaaac
aaggaggaaagacaagccaaacaacgttacctgcagatattctacaatgttcagtatagg
aacctggcaaaggctatggcaagagcaggggatcaacaggctcggcaaaccacaacaggc
gtggcgcctagtgagatcgtagttagacccaaagaaagaaagccgcagactcggatgcaa
aggatcttaaccaggttagccgggcagaagcctccagtttctgagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340386
Entry
4340386           CDS       T01015                                 
Name
(RefSeq) sucrose synthase 2
  KO
K00695  sucrose synthase [EC:2.4.1.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4340386
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4340386
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.13  sucrose synthase
     4340386
Glycosyltransferases [BR:osa01003]
 Others
  Other glycosyltransferases
   4340386
SSDB
Motif
Pfam: Sucrose_synth Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_1_2
Other DBs
NCBI-GeneID: 4340386
NCBI-ProteinID: XP_015643025
UniProt: P30298 I3QD82
LinkDB
Position
6:complement(4796545..4804283)
AA seq 808 aa
MAAKLARLHSLRERLGATFSSHPNELIALFSRYVNQGKGMLQRHQLLAEFDALIEADKEK
YAPFEDILRAAQEAIVLPPWVALAIRPRPGVWDYIRVNVSELAVEELSVSEYLAFKEQLV
DGHTNSNFVLELDFEPFNASFPRPSMSKSIGNGVQFLNRHLSSKLFQDKESLYPLLNFLK
AHNHKGTTMMLNDRIQSLRGLQSSLRKAEEYLMGIPQDTPYSEFNHRFQELGLEKGWGDC
AKRVLDTIHLLLDLLEAPDPANLEKFLGTIPMMFNVVILSPHGYFAQSNVLGYPDTGGQV
VYILDQVRALENEMLLRIKQQGLDITPKILIVTRLLPDAVGTTCGQRVEKVIGTEHTDIL
RVPFRSENGILRKWISRFDVWPFLETYTEDVANEIMREMQAKPDLIIGNYSDGNLVATLL
AHKLGVTQCTIAHALEKTKYPNSDIYLDKFDSQYHFSCQFTADLIAMNHTDFIITSTFQE
IAGSKDTVGQYESHIAFTLPGLYRVVHGIDVFDPKFNIVSPGADMSVYFPYTEADKRLTA
FHPEIEELLYSEVENDEHKFVLKDKNKPIIFSMARLDRVKNMTGLVEMYGKNAHLRDLAN
LVIVCGDHGNQSKDREEQAEFKKMYGLIDQYKLKGHIRWISAQMNRVRNGELYRYICDTK
GVFVQPAFYEAFGLTVIEAMTCGLPTIATCHGGPAEIIVDGVSGLHIDPYHSDKAADILV
NFFEKCKQDSTYWDNISQGGLQRIYEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRR
YIEMFYALKYRSLASAVPLAVDGESTSK
NT seq 2427 nt   +upstreamnt  +downstreamnt
atggctgccaagctagctcgcctccacagtctccgcgaacgcctcggtgccaccttctcg
tctcatcccaatgagttgattgcactcttctctaggtatgttaaccagggaaagggaatg
ctccagcgtcaccagctgcttgcggagttcgatgccttgatcgaagctgacaaagagaaa
tatgctccctttgaagacattctccgggctgctcaggaagccattgtgctgccgccctgg
gttgcactggccatcaggccaaggcctggtgtctgggactacattcgggtgaatgtaagt
gagttggcagtggaagagctgagtgtttctgagtacttggcattcaaggaacagcttgtt
gatggacacaccaacagcaactttgttcttgagcttgattttgagcccttcaatgcctcc
ttcccgcgcccgtccatgtccaagtccatcggaaatggggtgcagttccttaaccgtcac
ctgtcgtccaagttgttccaggacaaggagagcctctaccccttgctgaacttcctgaaa
gcccataaccacaagggcacgacaatgatgctgaatgacagaattcagagccttcgtggg
ctccaatcatcccttagaaaggcagaagaatatctgatgggcattcctcaagacacgccc
tactcggagttcaaccacaggttccaagagctcggtttggagaagggttggggtgactgt
gcaaagcgtgtgcttgacaccatccacttgcttcttgaccttcttgaggcccctgatccg
gccaacttggagaagttccttggaactattccaatgatgttcaatgttgttatcctgtct
ccgcatggatactttgcccaatccaatgtgttgggataccctgatactggtggtcaggtt
gtgtacattttggaccaagtccgcgctttggagaatgagatgcttttgaggatcaagcag
caaggccttgatatcacacctaagatcctcattgtaaccaggctgttgcctgatgctgtt
ggtactacatgcggccagcgtgtggagaaggttattggaactgagcacactgacattctt
cgtgttccattcaggagtgagaatggtatcctccgcaagtggatctcccgttttgatgtc
tggccattcctggaaacatacactgaggatgttgcaaacgaaattatgagggaaatgcaa
gccaaacctgatctcatcattggcaattacagtgatggaaaccttgttgccactctgctg
gctcacaaattaggagttacccagtgtaccattgctcatgccttggagaaaaccaaatac
cccaactcagacatatacttggacaagtttgacagccagtaccacttctcatgccaattc
actgctgatcttatcgccatgaatcacactgatttcatcatcaccagtacattccaagaa
attgctggaagcaaggacactgtggggcagtatgaatcacacattgcattcacccttcct
gggctttaccgagttgtgcatggcatagatgtttttgatcccaagttcaacattgtctct
cctggagctgacatgagtgtctacttcccgtacaccgaggctgacaagaggctcactgct
ttccaccctgaaattgaggagcttctctacagtgaagtcgagaacgatgaacacaagttt
gtattgaaggacaagaacaagccaatcatcttctccatggctcgtcttgaccgagtgaag
aacatgacaggtctggttgagatgtatggtaagaatgcacatctcagggatttggcaaac
cttgtgattgtttgtggtgaccacggcaatcagtccaaggacagggaggagcaggctgag
ttcaagaagatgtacggtctcattgaccagtacaagttgaaggggcatatccgctggatc
tcagctcagatgaaccgtgttcgtaacggggagttgtaccgatacatttgtgacaccaag
ggagtctttgtccagcctgcattctatgaagcgtttggtctgactgtcatcgaagccatg
acatgtggtttgccaacaatcgcaacatgccatggtggccctgctgagattattgttgat
ggggtgtctggtctgcacattgatccttaccacagtgacaaggctgctgatatcttggtc
aacttctttgagaagtgcaagcaggattcaacctactgggacaatatttcacagggaggt
ctgcagaggatttacgagaagtacacctggaagctgtactctgagaggctgatgaccttg
actggtgtatacggattctggaagtacgtaagcaaccttgagaggcgcgagactcgccgt
tacattgagatgttctatgctctgaaataccgcagcctggccagcgccgtcccattggct
gtcgatggagagagcacatccaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343910
Entry
4343910           CDS       T01015                                 
Name
(RefSeq) sucrose synthase 3
  KO
K00695  sucrose synthase [EC:2.4.1.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4343910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4343910
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.13  sucrose synthase
     4343910
Glycosyltransferases [BR:osa01003]
 Others
  Other glycosyltransferases
   4343910
SSDB
Motif
Pfam: Sucrose_synth Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_1_2
Other DBs
NCBI-GeneID: 4343910
NCBI-ProteinID: XP_015644807
UniProt: Q43009
LinkDB
Position
7:25429550..25435142
AA seq 816 aa
MGETTGERALTRLHSMRERIGDSLSAHTNELVAVFSRLVNQGKGMLQPHQIIAEYNAAIP
EGEREKLKDSALEDVLRGAQEAIVIPPWIALAIRPRPGVWEYLRINVSQLGVEELSVPEY
LQFKEQLVDGSTQNNFVLELDFEPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESM
YPLLNFLRAHNYKGMTMMLNDRIRSLDALQGALRKAEKHLAGITADTPYSEFHHRFQELG
LEKGWGDCAQRVRETIHLLLDLLEAPEPSALEKFLGTIPMVFNVVILSPHGYFAQANVLG
YPDTGGQVVYILDQVRAMENEMLLRIKQQGLNITPRILIVTRLLPDAHGTTCGQRLEKVL
GTEHTHILRVPFRTENGTVRKWISRFEVWPYLETYTDDVAHEISGELQATPDLIIGNYSD
GNLVACLLAHKLGVTHCTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTADLIAMNHADF
IITSTFQEIAGNKETVGQYESHMAFTMPGLYRVVHGIDVFDPKFNIVSPGADMSIYFPFT
ESQKRLTSLHLEIEELLFSDVENTEHKFVLKDKKKPIIFSMARLDHVKNLTGLVELYGRN
PRLQELVNLVVVCGDHGKESKDKEEQAEFKKMFNLIEQYNLNGHIRWISAQMNRVRNGEL
YRYICDMRGAFVQPALYEAFGLTVIEAMTCGLPTFATAYGGPAEIIVHGVSGYHIDPYQN
DKASALLVEFFEKCQEDPNHWIKISQGGLQRIEEKYTWKLYSERLMTLSGVYGFWKYVTN
LDRRETRRYLEMLYALKYRKMATTVPLAIEGEASTK
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgggggaaactactggagaacgtgccctgacccgtctccacagcatgagggagcgcatc
ggcgattccctctccgcgcacaccaatgagcttgtggctgtcttctcaaggcttgtgaac
caaggaaagggaatgctacagccccaccagatcattgctgagtacaacgccgcaatccct
gagggcgagcgtgagaagctgaaggactctgccttagaggatgtcctgaggggagcacag
gaggcgattgtcatccctccatggattgcccttgccattcgcccaaggcctggtgtctgg
gagtatctgaggatcaatgtaagccagcttggtgttgaggagctgagtgtccctgaatac
ttgcagttcaaggagcagcttgtggatggaagcacccagaacaactttgtgcttgagctg
gactttgagccattcaatgcctccttccctcgcccatcgttgtcgaagtctattggcaat
ggggtgcagttcttgaacaggcacctgtcgtcaaagctgttccatgacaaagagagcatg
taccccctgctcaactttcttcgtgcgcacaactacaaagggatgaccatgatgttgaac
gacaggattcgcagtctcgatgctctccaaggtgcattgaggaaggcagaaaaacatctt
gcaggcattacagctgacaccccatattcagagttccatcacaggttccaagagcttggt
ttggagaagggttggggtgactgcgctcagcgagtgcgtgagactattcaccttctcttg
gaccttcttgaggcccctgagccgtccgccttggagaagttccttggaacaatcccaatg
gtgttcaatgttgttatcctctccccgcatggttactttgcacaggctaatgtcttgggg
taccctgataccggtgggcaggttgtctacattttggatcaagtccgtgctatggagaat
gagatgctgctgaggatcaagcaacaaggtctaaacatcacaccaaggattctcattgtg
accaggttgctacctgatgcgcatggcaccacatgtggccagcgccttgagaaggtccta
ggcactgagcacactcatatcctgcgtgtgccattccgaacagaaaatgggactgttcgc
aaatggatctcgcgttttgaagtctggccttacctggaaacttacaccgatgatgtggca
cacgagatttctggagagctgcaggccacccctgacctgatcattgggaactacagtgat
ggcaaccttgttgcatgtttgctggcacacaagttgggtgtcactcattgtacaatcgcc
catgcacttgagaaaaccaagtaccccaactccgacctttactggaagaagtttgaggat
cactatcacttctcctgccagttcacagctgacctgattgcaatgaaccatgctgacttc
atcatcacaagtaccttccaggagattgctggaaacaaggaaactgtggggcagtatgag
tctcacatggcattcacaatgcctggcctttatcgtgttgtccatggtatcgatgtcttt
gaccccaagttcaacatcgtctctcctggtgctgacatgtccatctacttcccattcacc
gaatcacagaagaggctcacctctctccatttagagatagaggagctactcttcagtgat
gttgaaaacactgagcacaagtttgttctgaaggacaagaagaagccaatcatcttctcg
atggctaggctagaccatgtcaagaatttgactggtctggttgagttgtatggtcggaac
cctcgcctgcaagagctagtaaaccttgtggttgtctgtggtgaccatggcaaggaatcc
aaggacaaagaagagcaggctgagttcaagaagatgtttaatctgatcgagcagtacaat
ttgaatggccacatccgctggatctccgctcagatgaaccgtgtccgcaatggtgagctc
taccgctacatctgcgacatgaggggagcctttgtgcagcccgctctctatgaggccttt
gggctaactgtgattgaggccatgacctgtggtcttccaacatttgcaactgcctatggt
ggtccagccgagatcatcgtgcacggcgtgtctggctaccacattgatccttaccagaac
gacaaggcctcggcgctgctcgtggagttctttgagaagtgtcaggaagacccaaaccac
tggatcaagatctcgcagggtggacttcagcgcatcgaggagaagtacacatggaagctc
tactctgagaggctgatgactctctccggtgtctacggtttctggaagtatgtcaccaac
ctcgacaggcgtgagacacgccgctacctggagatgctgtacgccctcaagtaccgcaag
atggctaccaccgttccattggccattgagggagaggcctccaccaaatga

DBGET integrated database retrieval system