KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331255
Entry
4331255           CDS       T01015                                 
Name
(RefSeq) homoserine kinase
  KO
K00872  homoserine kinase [EC:2.7.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4331255
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     4331255
SSDB
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Other DBs
NCBI-GeneID: 4331255
NCBI-ProteinID: XP_015624618
UniProt: Q6K969 A0A0P0VRQ4
LinkDB
Position
2:35772170..35774782
AA seq 378 aa
MAAAAAAAAAPSPAPCFPSTRHTLPGLVSVRVSRRVKVAVAIADPAPAFNSVTAFAPATV
ANLGPGFDFLGCAVADASLSLGDTVTATLDPSLPPGTVAIASVTSPSRPTLADRLSRDPL
RNCAGVAAIAALRALDVKSHAVSIHLTKGLPLGSGLGSSAASAAAAAKAVDALFGSLLHQ
DDLVLAGLESEKAVSGFHADNIAPAILGGFVLVRSYDPFHLIPLSSPPALRLHFVLVTPD
FEAPTSKMRAALPKQVAVHQHVRNSSQAAALVAAVLQGDATLIGSAMSSDGIVEPTRAPL
IPGMAAVKAAALEAGALGCTISGAGPTAVAVIDGEEKGEEVGRRMVEAFANAGNLKATAT
VAQLDRVGARVISTSTLE
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcggcggcgccctctccggctccctgcttcccttccacc
cgccacacgctgcctgggctcgtatctgtccgcgtctctcggagagtcaaagtcgccgtc
gccatcgccgaccccgctccggccttcaactccgtcacggccttcgcgcccgccaccgtc
gccaacctcggcccgggattcgacttcctcggctgcgccgtcgccgacgcctccctctcc
ctcggcgacaccgtcaccgctaccctcgacccctccctgccccccggcaccgtcgccatc
gcatccgtcacctccccctcccgccccaccctcgccgaccgcctctcccgcgaccccctc
cgcaactgcgccggagtcgccgccatcgctgcccttcgcgccctcgatgtcaagtcccac
gccgtctccatccacctcaccaagggcctccccctcggctccggcctcggctcctccgcc
gcctccgccgccgccgctgccaaggccgttgacgccctcttcggctccctcctacaccaa
gatgacctcgtcctcgcgggcctcgagtccgagaaagccgtcagtggcttccacgccgac
aacatcgccccggccatcctcggcggcttcgtcctcgtccgcagctacgaccccttccac
ctcatcccgctctcctccccacctgccctccgcctccacttcgtcctcgtcacgcccgac
ttcgaggcgcccaccagcaagatgcgtgccgcgctgcccaaacaggtggccgtccaccag
cacgtccgcaactccagccaagcggccgcgcttgtcgccgctgtgctgcaaggggacgcc
accctcatcggctccgcaatgtcctccgacggcatcgtggagccaaccagggcgccgctg
attcctggcatggctgcggtcaaggccgcggcgttggaagctggggcattgggctgcacc
atcagtggagcagggccaactgctgtggctgtcattgacggggaggagaagggcgaggag
gttggccggaggatggtggaggcattcgccaatgccggcaatctcaaagcaacagctact
gttgctcagctcgatagagttggtgccagggttatctctacctccactttggagtag

DBGET integrated database retrieval system