KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331263
Entry
4331263           CDS       T01015                                 
Name
(RefSeq) alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase isoform X1
  KO
K00726  alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.101]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4331263
   00513 Various types of N-glycan biosynthesis
    4331263
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4331263
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.101  alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     4331263
Glycosyltransferases [BR:osa01003]
 Glycan extension
  N-Glycan
   4331263
SSDB
Motif
Pfam: GNT-I MGAT2 Glyco_tranf_2_3 Glycos_transf_2 Glyco_transf_25
Other DBs
NCBI-GeneID: 4331263
NCBI-ProteinID: XP_015624616
UniProt: Q6K959 B9F4Q0
LinkDB
Position
2:complement(35812504..35818214)
AA seq 442 aa
MARSPCDLRILLVAAAAAFIYIQVRLFSTQSHYADRLAQAEKSENQCTSQLRSLIDQVSS
QQEKIVALEEMKIRQDEERVHLKILIQDLEKRSVQTLVNNNVAPVAAVVVMACNRPDYLQ
RTVESILKYQTSVASKFPLFISQDGINGEVKKKALSYNEITYMQHLDLEPVRTERPGELI
AYYKIAKHYKWALDELFIKHNFARVIILEDDMEIAPDFFDYFEAAAKLLDNDKTIMAVSS
WNDNGQKQFVYDPKALYRSDFFPGLGWMLTKPTWIELSPKWPKAYWDDWVRLKEVHRDRQ
FIRPEVCRTYNFGEHGSSMGQFFRQYLEPIKLNDAHIKWNSEDLSYLKEDKFLIQFGKDV
ASATPLHGSDAALKAHNMDADVRIQYNDQEDFERIARQFGIFEEWKDGIPRTAYKGVVVF
RYKSSRRRIYLVGPDSLSQLRV
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggcgcggagcccctgcgacctccgcatcctcctcgtcgccgccgctgcagccttcatc
tacatccaagtccgccttttttctactcagtcccactacgccgaccgcctcgcacaagca
gaaaaatccgaaaaccaatgcaccagtcaactccgctccttgatcgatcaagtcagctct
cagcaggagaagattgtcgcgttggaagagatgaagatacgccaagacgaagaacgtgta
cacctcaagattttaatccaagatctcgaaaaaaggagcgtgcagaccttagtaaacaac
aatgtggctcctgttgctgctgttgttgtaatggcttgcaatcgaccagactatttgcaa
aggacagttgaatctatcctgaagtatcagacatcagtggcttcaaagtttccactattt
atatctcaggatggaataaatggagaagtgaagaaaaaagctttgagttataatgaaata
acatatatgcagcatttagatcttgaacctgtgcgcactgaaaggccaggagagttgata
gcatattacaagatagccaaacattacaaatgggccttggatgagctattcatcaaacac
aactttgcgcgagtaataattctggaagatgatatggagatcgcccctgatttttttgac
tacttcgaggctgcagctaaattacttgataacgataagacaatcatggccgtttcttcc
tggaatgacaatggacaaaagcaatttgtttacgacccaaaagctctttaccggtcggat
ttctttcctggacttggatggatgttaacaaagcctacatggattgagctgtcacctaag
tggcccaaagcttattgggatgactgggtgaggctaaaagaggtacacagagaccggcaa
tttattcgcccggaagtctgcagaacatacaattttggcgaacatgggtcaagcatgggg
caattcttcagacagtacttggaaccaatcaagctaaatgatgcccatatcaagtggaat
tctgaggacctgagctacctcaaggaggacaagttcctgatccaatttgggaaagacgtc
gctagtgccacccctctccatggatctgatgccgcgttgaaagcccacaatatggatgcg
gatgtaaggatccagtataacgatcaggaagactttgagcggatagctcgtcaatttgga
atatttgaagaatggaaggatggcattccaagaacagcttataaaggagtagtagtcttc
cggtacaagagtagtcgaagacgaatatacctcgttggtccggattccctcagtcagctt
agggtatag

DBGET integrated database retrieval system