KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331279
Entry
4331279           CDS       T01015                                 
Name
(RefSeq) DNA repair endonuclease UVH1
  KO
K10848  DNA excision repair protein ERCC-4 [EC:3.1.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    4331279
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4331279
   03400 DNA repair and recombination proteins [BR:osa03400]
    4331279
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-
    3.1.-.-
     4331279
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    4331279
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     4331279
SSDB
Motif
Pfam: ERCC4 DUF4780
Other DBs
NCBI-GeneID: 4331279
NCBI-ProteinID: XP_015630768
UniProt: B9F9Z6 Q10T59
LinkDB
Position
3:66263..71754
AA seq 995 aa
MLPFEEQVVADLLEDPNGGLVVVSCGLPVASLASAVLLQLFHQSPDDGCFLILSAPEPVK
AQIRRRLLLNSQSQPPLLQLQVHDVAPDLPAHHRVALYASRAALFLSPRALVADFLTSRL
LPSRVRALLLLSAHRSSDTSSDAFVARLLRHHHLLPVYAFSDRPHAMVSGFAKAERAMKS
LYIRRLHLWPRFHLLAAADLERSPPEVIDVRVPMTQPMRGIQAAILDAMDACLKELRRTN
KVDVEDLTVDKGLFKSFDEIVRRQLDPIWHTLGKKTKQLVADLRTLRKLLDYLVRYDAVT
YLKYLDTLRVSEGVRSVWIFADSSHKIFDLSKRRVYQVVRADGTKVAADNKGTPTKKRKV
ARASSRKGKETENEGSSDNKDNTQKVNAEMGIVVEEILEEAPKWKVLRELLQEIAEEQAK
GDGDNVNPVHEDGINESGIVLVACKDERSCVQLQECISKGSHQVMRAEWEKYLLGKAELH
GLHRKNKKTSQQLKGFGVLDGEVPMRSGESAGPVSISKVEANALLAAASEISTVTKEANL
ADDSNVSCKKRSFGKGKGKGKFKKTMAKREASKLRNRNTTEHTDLEVEGQSGKTDEQAET
DACKLSAEDDSASAPAVDKAANNLSAFGDSVDTEPLPPVQFYALDSDQHVLDVWKPSVII
VYHPDITFVREIEVYKAENPSMKLKVYFLFYEDSAEVQKFESSIRRENEAFESLIRQKSL
MMIPVDQNGRCIGPTLANEPEALLSQNSLTRKAGGRKPLEKEMQVIVDMREFMSSLPNVL
HQKGIRIIPVTLEVGDYVLSPLICVERKSIADLFQSFASGRLYNQIETMVRYYKIPVLLI
EFSQDKSFSFQSASEIGDDVSPTNIISKLSLLVLHFPRLRIVWSRSLHATADIFLSLKTN
QDEPDESKAMRVGVPSEDGVVENDVRAENYNTSAIEFLRRLPGVTDSNYRRIMEECNSLA
ELALLPVERLSELMGTQKGARMLKEFLDAKCPTML
NT seq 2988 nt   +upstreamnt  +downstreamnt
atgcttcccttcgaggagcaggtggtggcggacctcctggaggaccccaacggcggcctg
gtggtggtttcgtgtggcctcccggtggcctccctggcgtccgccgtcctcctccagctc
ttccaccaatcccccgacgatggctgcttcctgatcctctccgcccccgagccggtcaaa
gctcaaatccggcggcgcctcctcctcaactcccagagccagcctcctctcttgcagctg
caggtccacgacgtggcccccgacctccccgcccaccaccgcgtcgccctctacgcctcc
cgcgccgcgctcttcctctccccccgcgccctcgtcgccgacttcctcacctcccgcctc
ctcccctcccgcgtccgcgccctcctcctcctctccgcccaccgctcctccgacacctcc
tccgacgccttcgtggctcgcctcctccgccaccaccacctcctccctgtttatgccttc
tccgatcgcccccatgccatggtctccggcttcgccaaggcggagcgcgctatgaagagc
ctctacattcgacgcctccacctttggccccgcttccaccttcttgctgccgctgacctc
gagcgctccccgcccgaggtcatcgacgtccgcgtccccatgactcagcctatgaggggc
atccaggccgctatcctcgatgccatggacgcctgcctcaaggagctcaggcggaccaac
aaggtcgacgtcgaagacctcaccgtcgacaagggcctcttcaagtcttttgatgagatc
gtcaggaggcagctcgaccccatctggcacacgctcggcaagaagaccaagcagctcgtc
gccgacctcaggacgctacgcaagctgcttgattatcttgtcaggtacgatgctgtgaca
taccttaagtacctggacacactcagagtatctgaaggcgtccgatctgtttggatattt
gctgactcaagccacaagatattcgacctttcaaaaaggcgtgtctaccaggttgtgaga
gcagacggtacaaaggttgcagcagacaacaagggcacaccaacaaagaagaggaaggtg
gcacgcgctagcagcaggaaaggaaaagaaactgaaaatgagggttccagtgataacaag
gacaatactcagaaggttaatgcagagatgggcattgtagtggaggagattttagaggaa
gcacctaaatggaaggttttacgggaactattgcaggagatagcagaagaacaggcaaag
ggagatggtgacaatgtaaaccctgttcatgaagacggaattaacgagagtggcatagtt
ttggtagcatgcaaagatgagcgctcatgcgtgcagctgcaagaatgcatatcaaaaggc
tcgcatcaggtcatgcgggccgagtgggagaagtacttgcttggcaaagctgaactgcat
ggattgcataggaagaacaagaaaacatctcagcaactaaaagggtttggtgttctggat
ggggaagttcctatgaggtctggtgagagtgcaggtcctgttagcattagcaaggttgag
gctaatgccttacttgcggctgcctctgaaataagcactgtaactaaggaagcaaatctt
gctgatgattcaaatgtcagctgcaagaagagatcattcggaaaagggaaagggaaaggg
aaatttaagaaaaccatggcaaagagagaagccagtaagttgagaaacagaaatactaca
gaacatactgatttggaagttgaaggtcaatcaggaaaaacagatgaacaggctgagact
gatgcttgtaagttgtctgcagaagatgattctgcatcagctccagctgttgacaaagct
gctaacaatttatctgcttttggagactctgtggataccgaaccactacctcctgtgcaa
ttttacgccctagacagtgatcagcatgtacttgatgtatggaaaccttctgtaattatc
gtttatcatccagatataacatttgttagagaaattgaagtatacaaggcagaaaatcca
tcgatgaagttaaaagtttactttcttttttatgaagattctgccgaggtacaaaaattt
gagtccagcattcgccgggaaaatgaagcatttgaatctttgatcagacagaagtcgctg
atgatgatacctgttgatcagaatggccgttgcattggaccaactcttgcaaatgaacca
gaagctcttttatctcaaaattcactaacaagaaaggcaggtggtagaaagccactagag
aaggagatgcaggttattgtggacatgagagaattcatgagcagtcttcctaatgtattg
caccagaaaggtattcgaataatacctgttaccttggaagtcggtgactatgttctttct
cctttgatctgtgtcgaacgaaaaagtattgcggacttgttccaaagctttgcttctggt
cgtctctacaatcagattgaaaccatggttcggtattacaagatcccagtgcttctgata
gaattctcacaagacaagagcttttcctttcagtctgcaagtgaaattggggatgatgta
tctccgacaaatataatctcaaaactttcattactagtcctgcattttcctcggcttcgc
atagtctggtctcgcagcttgcatgccacggcagatatattcctatcactcaaaacaaac
caggatgaacctgatgagagcaaggcaatgagagttggtgtgccctctgaggacggagtt
gtggagaatgacgtgagggctgaaaattacaatacgtccgcgattgaattcttgaggagg
cttcctggtgtgacagattcaaactatagaagaataatggaggaatgcaatagcttagca
gagctggccctgcttccggtagagcggctgtctgagttgatgggtactcagaaaggggca
cgcatgctcaaggaatttctcgatgccaagtgtccaactatgctctag

DBGET integrated database retrieval system