KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331322
Entry
4331322           CDS       T01015                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 5, chloroplastic isoform X1
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00280  Valine, leucine and isoleucine degradation
osa00290  Valine, leucine and isoleucine biosynthesis
osa00770  Pantothenate and CoA biosynthesis
osa00966  Glucosinolate biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
osa01240  Biosynthesis of cofactors
Module
osa_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
osa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
osa_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4331322
   00280 Valine, leucine and isoleucine degradation
    4331322
   00290 Valine, leucine and isoleucine biosynthesis
    4331322
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4331322
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    4331322
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4331322
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     4331322
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class IV
   4331322
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 4331322
NCBI-ProteinID: XP_015629164
UniProt: Q8H7T7 Q0DVY9
LinkDB
Position
3:complement(375274..381260)
AA seq 405 aa
MELHLTSRGALPLSPPLAGQRRPHLSLSTPSLPIKNHTYSVPPPFSKAHCAIGCQASLAT
NYMETSAVADLDWENLGFGLVQTDFMYIAKCGPDGNFSKGEMVPFGPIELSPSAGVLNYG
QGLFEGLKAYRKTDGYILLFRPEENAIRMRNGAERMCMPAPTLEQFVDAVKQTVLANKRW
VPPTGKGSLYIRPLLMGSGAVLGLAPAPEYTFMIFVSPVGNYFKEGLAPINLIIEENFHR
AAPGGTGGVKTIGNYASVLKAQRIAKQKGYSDVLYLDAVHKKYLEEVSSCNIFIVKGNVI
STPAIKGTILPGITRKSILEVAQRKGFMVEERLVSVDELLEADEVFCTGTAVVVSPVGSI
TYLGQRVEYGNQGVGVVCQQLYTSLTSLQMGHVDDCMGWTVELNQ
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggagctccacctcacctcccgcggcgccctcccgctgtctccgccgctcgccggccag
cggcgtcctcacctctctctctccacgccgtcgcttccgatcaagaatcacacttattca
gtgccacctcctttctccaaggctcactgcgcgataggatgccaagcttctctagcaact
aactacatggaaacctctgcggtggctgatttggactgggagaacctcggttttggcctt
gtccagacagattttatgtatattgcaaaatgcgggccagatgggaacttttccaaagga
gaaatggtaccatttggacctatagaactgagcccatctgctggagtcttaaattatgga
cagggcttgtttgagggcttaaaggcatatagaaaaacagatggatacattctgctgttt
cgtccggaggagaatgccataaggatgagaaatggtgcagagaggatgtgtatgcctgca
ccaactcttgaacaatttgtggatgcagtaaagcaaaccgttttggcaaataaaagatgg
gtgcccccaaccggtaaaggctccctgtatataaggccgctgcttatgggaagtggagct
gtccttggtcttgcacctgctcctgagtatacctttatgatttttgtctcccctgttggg
aactatttcaaggaaggtttagcccctattaacttgattatagaagaaaactttcaccgt
gctgcccctggtggaactggcggagtgaaaaccattggaaactatgcctcggtattaaaa
gcacagaggattgcaaaacagaaaggatattcagatgtcctctatctagatgccgttcac
aagaaatatctggaagaagtgtcttcgtgcaatatctttattgtgaaaggcaatgttatt
tctactccagcaataaaaggaaccatactgcctggtataacaaggaaaagtattcttgaa
gttgctcagagaaaaggcttcatggttgaggagcgccttgtgtcagtggatgagcttctt
gaagctgatgaagttttctgcacgggaacagctgttgtggtgtcccctgtggggagcata
acttatctggggcaaagggtggaatatggcaaccaaggagtgggcgtggtgtgtcagcag
ctgtatacttcacttacaagcctccagatgggtcatgtggacgattgtatgggctggact
gtggaactaaaccagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332151
Entry
4332151           CDS       T01015                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 2, chloroplastic
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00280  Valine, leucine and isoleucine degradation
osa00290  Valine, leucine and isoleucine biosynthesis
osa00770  Pantothenate and CoA biosynthesis
osa00966  Glucosinolate biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
osa01240  Biosynthesis of cofactors
Module
osa_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
osa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
osa_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4332151
   00280 Valine, leucine and isoleucine degradation
    4332151
   00290 Valine, leucine and isoleucine biosynthesis
    4332151
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4332151
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    4332151
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4332151
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     4332151
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class IV
   4332151
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 4332151
NCBI-ProteinID: XP_015630708
UniProt: Q0DTR3 Q8GRH8
LinkDB
Position
3:6948000..6950926
AA seq 415 aa
MAAAAAAASSAKRALLPWARDAHHALARALQGCGGGGGLGLRGALPTAGGRWSLLQCRWR
SSLPQLDSADRSDEESGGEIDWDNLGFGLTPTDYMYVMRCSLEDGVFSRGELSRYGNIEL
SPSSGVINYGQGLFEGLKAYRAANQQGSYMLFRPEENARRMQHGAERMCMPSPSVEQFVH
AVKQTVLANRRWVPPQGKGALYIRPLLIGSGPILGLAPAPEYTFLIYAAPVGTYFKEGLA
PINLVVEDSIHRAMPGGTGGVKTITNYAPVLKAQMDAKSRGFTDVLYLDAVHKTYLEEAS
SCNLFIVKDGVVATPATVGTILPGITRKSVIELARDRGYQVEERLVSIDDLVGADEVFCT
GTAVVVAPVSSVTYHGQRYEFRTGHDTLSQTLHTTLTSIQMGLAEDKKGWTVAID
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggctgctgctgctgctgctgcgtcgtccgcgaagcgcgcgctcctcccgtgggcacgc
gacgcccaccacgcgctggccagggccctgcagggatgcggcggcggcggcggcctcggt
ctccgcggggcgctcccgacggccggaggcaggtggtctctgctccagtgccggtggagg
tcgtcgctgccgcagctcgactccgccgacaggtccgatgaggaaagcggcggcgaaatc
gactgggacaacctggggttcgggctgacgccgaccgactacatgtacgtcatgcggtgc
tcgctggaggacggcgtcttctcccgcggcgagctcagccgctacggcaacatcgagctc
agcccctcctccggcgtcatcaactacggccaggggctcttcgagggtctgaaggcgtac
agggcggcgaaccaacaggggtcgtacatgctgttccggccggaggagaacgcgcggcgg
atgcagcacggcgccgagcgcatgtgcatgccgtcgccgtcggtggagcagttcgtccac
gccgtcaagcagaccgtcctcgccaaccgccgctgggtgccaccgcaaggaaagggggcg
ctgtacatcaggccgctgctcatcgggagcggaccgattctcgggctggctcccgccccg
gagtacacgttcctcatctacgccgcaccggttggaacgtacttcaaggagggtctagcg
ccgataaaccttgtcgtagaggactcgatacaccgggccatgccgggcggcaccggcggg
gtcaagacgatcaccaactacgcgccggtgctcaaggcgcagatggacgccaagagcaga
gggttcactgacgtgctgtacctcgacgcggtgcacaagacgtacctggaggaggcctcc
tcctgcaacctcttcatcgtcaaggacggcgtcgtcgccacgccggccaccgtgggaacc
atcctgccggggatcacgcgcaagagcgtcatcgagctcgccagggaccgcggctatcag
gttgaagaacggctcgtctccatcgacgatctggtcggcgcagacgaggtgttctgcacc
ggaacagcggtggtcgttgccccagtatcgagtgttacttaccatgggcaaaggtacgag
ttcaggactggacatgacacgttatcgcagacactgcacacgactctgacgtccatccag
atgggcctggctgaggacaagaaaggatggacagtggcaatagattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336645
Entry
4336645           CDS       T01015                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 3, chloroplastic isoform X1
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00280  Valine, leucine and isoleucine degradation
osa00290  Valine, leucine and isoleucine biosynthesis
osa00770  Pantothenate and CoA biosynthesis
osa00966  Glucosinolate biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
osa01240  Biosynthesis of cofactors
Module
osa_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
osa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
osa_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4336645
   00280 Valine, leucine and isoleucine degradation
    4336645
   00290 Valine, leucine and isoleucine biosynthesis
    4336645
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4336645
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    4336645
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4336645
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     4336645
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class IV
   4336645
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 4336645
NCBI-ProteinID: XP_015633613
LinkDB
Position
4:complement(28026461..28030653)
AA seq 418 aa
MELLPRVGVAAPGPGRGGASPSPTRRHRAPSHPILKRSAAVCGAVAVCRGGAVARRSRWS
TLVTAAYYTGTAELVDFNWETLGFQPVPTDFMYVMRCSEEGVFTKGELVPYGPIELNPAA
GVLNYGQGLLEGLRAHRKEDGSVLLFRPDENALRMRVGADRLCMPAPSVEQFLEAIKLTI
LANKRWVPPTGKGSLYIRPLLIGSGAILGVAPAPEYTFVVFACPVGHYFKDGLSPISLLT
EEEYQCAAPGGTGDIKTIGNYASVITFSFLQAVYAKERAKERGHSDVLYLDPVHKKFVEE
LSSCNIFMVKDNIISTPLLTGTVLPGITRRSIIEYARSLGFQVEECLITIDELLDADEVF
CTGTSVVLSSVGCIVYQGRRVEYGNQKFRTVSQQLYSALTAIQKGLVEDSMGWTVQLN
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggagctcctcccgcgtgtgggtgtggccgcccccggtcccggacgcggcggcgcgtcg
ccgtccccgacgcgccgtcatcgcgcgccctctcaccccattctgaagcgatcggcggcg
gtttgcggcgcagtcgccgtctgcagaggaggggctgtcgccaggaggagccggtggtca
actctggtgaccgcagcatattacacaggaactgctgaactggtcgactttaactgggaa
actcttgggtttcaacccgtgccgactgactttatgtatgtgatgagatgttccgaggaa
ggggtgttcaccaagggtgaattggtgccatatgggccaatagaactgaacccagcagct
ggagtgttgaattatggtcagggtttacttgaaggtctgcgagcacatagaaaagaggat
ggatcagtccttctatttcgtcctgatgaaaatgctttacggatgagagtaggcgcagac
cggttatgtatgcctgcaccaagtgtagagcagttcctagaagctataaagctaacaatt
ttagcaaacaagcgctgggtaccccctactggcaaaggttctttatatatcagaccgctg
ctgattggaagtggggctatcctcggtgttgcaccagccccagagtacacatttgttgtc
tttgcttgcccagttgggcactattttaaggatggcttatctccaatcagcttgttaacc
gaggaagaatatcagtgtgcggcaccaggtggaactggtgatataaagactatcggaaat
tatgcttcagtaattaccttttcttttctacaagccgtttatgctaaagaaagagctaag
gagagaggtcattctgatgttctttacttggatccagtgcataaaaagtttgttgaggaa
ctttcgtcctgtaatatattcatggtgaaggacaacattatttctactccactattaacg
ggaacagttcttcctggcatcacaagaagaagtataattgaatacgcccgtagccttgga
tttcaggttgaagagtgtcttattacaatagatgagttgcttgacgctgatgaagttttc
tgtactggaacttctgtggtactatcctctgttggttgcatagtgtaccaggggagaaga
gtggagtatgggaaccagaagttcagaactgtgtctcagcaactctattcagcacttacg
gctatccagaaaggcctcgtggaggacagtatgggatggactgtgcaactgaattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339583
Entry
4339583           CDS       T01015                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 5, chloroplastic isoform X1
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00280  Valine, leucine and isoleucine degradation
osa00290  Valine, leucine and isoleucine biosynthesis
osa00770  Pantothenate and CoA biosynthesis
osa00966  Glucosinolate biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
osa01240  Biosynthesis of cofactors
Module
osa_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
osa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
osa_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4339583
   00280 Valine, leucine and isoleucine degradation
    4339583
   00290 Valine, leucine and isoleucine biosynthesis
    4339583
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4339583
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    4339583
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4339583
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     4339583
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class IV
   4339583
SSDB
Motif
Pfam: Aminotran_4 DUF4649
Other DBs
NCBI-GeneID: 4339583
NCBI-ProteinID: XP_015639243
UniProt: B9FLK4 Q6AT43
LinkDB
Position
5:27778774..27784808
AA seq 409 aa
MEYGAATRGALLAAAPLSGARRSWLPLSSPPSPPSIQIQNRLYSISSLPLKARGVRRCEA
SLASDYTKASEVADLDWENLGFGIVQTDYMYITKCGQDGNFSEGEMIPFGPIALNPSSGV
LNYGQGLFEGLKAYRTTDDSILLFRPEENALRMRTGAERMCMPAPSVEQFVDAVKQTVLA
NKRWVPPTGKGSLYIRPLLMGSGAVLGLAPAPEYTFIIFVSPVGNYFKEGLAPINLIVED
KFHRATPGGTGSVKTIGNYASVLMAQKIAKEKGYSDVLYLDAVHKKYLEEVSSCNIFVVK
GNVISTPAVKGTILPGITRKSIIDVALSKGFQVEERLVSVDELLEADEVFCTGTAVVVSP
VGSITYQGKRVEYAGNKGVGVVSQQLYTSLTSLQMGQAEDWLVWTVQLS
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggagtacggtgcagcaacgcgtggcgcgctcctcgcggccgccccgctctccggcgcc
cggcgtagctggttgcccctctcatcgccgccgtcgccgccctctattcagattcagaat
cgactttattcgatatcgtcgcttccactaaaggctcgaggcgtgagaagatgcgaggct
tctctagcaagtgactacacgaaggcatctgaggtagctgatttagattgggagaacctt
ggttttggaatcgtgcagaccgactacatgtatatcacaaaatgcggacaggacgggaat
ttttctgagggtgaaatgattccatttggacctatagcgctgaacccatcttctggagtc
cttaattacggacagggattatttgaaggtctaaaagcatatagaacaacagatgactct
atcttattatttcgcccggaggaaaatgcactgagaatgagaacaggtgcagaaagaatg
tgcatgcctgcgcctagtgttgagcagtttgtggatgcagtaaagcaaactgttttagca
aacaagagatgggtgcctcctaccggtaaaggttctttgtatattagaccgctactcatg
ggtagtggtgctgttcttggtcttgcacctgctcctgagtatacgttcattatatttgtc
tcgcctgtggggaactactttaaggaaggtttagctccaataaatttgatagttgaagat
aagtttcatcgtgcaacccctggtggaactggaagtgtgaagaccataggaaattatgcc
tcggtcttgatggcacagaagattgcaaaagaaaagggctattctgatgttctctacttg
gatgctgttcacaaaaagtatcttgaagaagtttcttcatgtaatatttttgttgtcaag
ggcaatgtcatttcaactccagcagtaaaaggaacaatattgccaggcatcacaaggaaa
agtatcattgatgttgctctgagcaagggtttccaggtcgaggagcgacttgtgtcagta
gatgagctgcttgaagctgatgaggttttctgcacaggaactgctgtcgtagtgtctcct
gtgggtagtattacctatcaagggaaaagggtcgaatatgctggcaacaaaggagttggt
gtcgtgtctcagcagctatatacttcattaacaagcctgcagatgggccaggcagaagat
tggctagtctggactgtgcaactgagttag

DBGET integrated database retrieval system