KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331530
Entry
4331530           CDS       T01015                                 
Name
(RefSeq) ATP phosphoribosyltransferase, chloroplastic
  KO
K00765  ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00340  Histidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    4331530
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     4331530
SSDB
Motif
Pfam: HisG HisG_C
Other DBs
NCBI-GeneID: 4331530
NCBI-ProteinID: XP_015631722
UniProt: Q10S55
LinkDB
Position
3:1909165..1919397
AA seq 404 aa
MSPMLATLPDVTAVLHSPSASPPSGLRAPAAVGMGMARTRFLAPRAAASAASAVSAKPAA
VAPLYADRTVVRIGLPSKGRMSEQTLSLLKSCQLSVRHLNPRQYTADIPQVPNLEVWFQR
PKDIVRKLQSGDLDLGIVGFDIVSEYGQGSDDLVVVHDALEFGHCRLSLAVPKEGIFENI
NTLEDLANMPEWTQERPLRVVTGFGYLGEKFMRENGFNHVSFLAGDGALESYPAMGMADV
IVDLVSSGTTLRENNLKEIDGGVVLESQATLVACRRSLHKRNGVLEITHEMLERLEAHLT
ATGEIMVTANMRGNSAEEVAERVLSQTSLCGLQGPTISPVYRSRDGKVAVEYYAINVVVP
QKSLYKSIQQLRSIGGSGVLVTKLTYIFDEETPRWRKLLSELGL
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcgccgatgctggcgacgctgccggacgtcacggccgtcctccactccccgtcggcc
tcgccgccgtccggcctccgcgcgccggcggctgtggggatggggatggcgaggacgcgc
tttctcgctccgcgggcggcggcttcggcggcctccgccgtctccgcgaagccggcggcg
gtggcgccgctgtacgcggaccgcacggtcgtccgtatcgggctccccagcaagggccgc
atgtccgagcaaaccctaagcctccttaagagttgccaattgtcagtcaggcacctcaac
ccgcggcagtacaccgcagatatcccgcaggtcccaaacttggaggtttggtttcagagg
cccaaagatattgtccgcaaactacaatctggggatcttgaccttggcattgttggtttt
gacatagtcagtgaatatgggcagggtagtgatgatttagtagttgttcatgatgctctc
gagtttggacattgtcgtttgtcccttgcggttcctaaggaaggcattttcgagaatata
aatactctggaggatttggcaaatatgcctgaatggacacaagagagaccattgcgtgtt
gttacaggatttggatatctaggagaaaagtttatgagagaaaatggtttcaatcatgtt
tcgtttttagctggagatggagctcttgaatcatatcccgctatgggtatggctgatgtt
atcgtggatcttgtgagtagtggaacaaccttacgtgagaataatttgaaggaaattgat
ggtggagtagttttggaaagccaggccacgcttgtcgcatgtaggagatcgctacacaaa
cgtaatggtgtcttggagattacgcatgagatgcttgaaagattagaggctcacctcaca
gcaactggggagataatggtcacagcaaacatgagggggaacagtgcggaagaagtggcg
gaaagagttctcagccaaacatcgttatgtggattacagggcccaaccataagtccagtc
taccgctcacgtgatgggaaggttgctgtggaatattatgcgattaatgtagtagttcca
cagaagtctctttacaagtccattcaacagctgagatctattggtggcagtggagtcttg
gtgacaaagctgacctacatatttgatgaggaaactcctagatggcgcaaactactttcg
gagctggggttgtga

DBGET integrated database retrieval system