KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331547
Entry
4331547           CDS       T01015                                 
Name
(RefSeq) putative aconitate hydratase, cytoplasmic
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
osa_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4331547
   00630 Glyoxylate and dicarboxylate metabolism
    4331547
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     4331547
SSDB
Motif
Pfam: Aconitase Aconitase_C
Other DBs
NCBI-GeneID: 4331547
NCBI-ProteinID: XP_015631409
UniProt: Q10S34 Q0DVC6
LinkDB
Position
3:complement(2026776..2033636)
AA seq 986 aa
MPPLTSALLSRSSSTRIPAAAAAAAAISNPAGAAASSSSPSPPPPSSRPRPASPFASGLA
GRIFGGRRAAARSSSSAAAVFERRFASAAAKNSYDEILTGLAKPGGGAEFGKYYSLPALS
DPRIERLPYSIRILLESAIRNCDEFQVTGKDVEKILDWENSAPKQVEIPFKPARVLLQDF
TGVPAVVDLACMRDAMSKLGSDPNKINPLVPVDLVIDHSVQVDVARSENAVQANMELEFH
RNKERFGFLKWGSTAFRNMLVVPPGSGIVHQVNLEYLARVVFNNGGILYPDSVVGTDSHT
TMIDGLGVAGWGVGGIEAEATMLGQPMSMVLPGVVGFKLTGKLRNGVTATDLVLTVTQML
RKHGVVGKFVEFYGGGMSELSLADRATIANMSPEYGATMGFFPVDGKTLDYLKLTGRSDD
TVAMIESYLRANKMFVDYNQPEAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSD
WLSCLDNDVGFKGFAVPKESQGKVAEFSFHGTPAKLKHGDVVIAAITSCTNTSNPNVMLG
AALVAKKACELGLEVKPWIKTSLAPGSGVVKKYLDKSGLQKYLDQLGFHIVGYGCTTCIG
NSGELDETVSAAISDNDIVAAAVLSGNRNFEGRVHALTRANYLASPPLVVAYALAGTVNI
DFEKEPIGISKDGKEVYFRDIWPSTEEIAEVVKSSVLPDMFKSTYEAITKGNPMWNELSV
SASTLYPWDPTSTYIHEPPYFKDMTMSPPGPRPVKDAYCLLNFGDSITTDHISPAGSIHP
DSPAARYLKERGVERKDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSG
EKLSVFDAATKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSN
LAGMGIIPLCFKSGEDADTLGLTGHERFTVHLPANVSEIKPGQDVTVTTDNGKSFTCTLR
FDTEVELAYYDNGGILPYVIRKIAEQ
NT seq 2961 nt   +upstreamnt  +downstreamnt
atgcctcccctcacgagcgccctcctctcccgctcctcctctacccgcatccccgccgcg
gcggcggcggcggcggcgatctcgaatcccgcgggcgccgccgcgtcgtcgtcgtcgccg
tcaccgccgcctccgagctctcgccccaggccggcgtcccccttcgcgtccggcctcgct
ggccgcatcttcggcggccgccgcgccgccgcgcgctcctcgtcgtccgccgcggccgtc
ttcgagcggcgcttcgcctcggcggcggcgaagaactcgtacgatgaaatcctgacgggc
ctcgcgaagccgggaggcggagcggagttcgggaaatactacagcctgcccgcgctatcc
gatccgcggatcgagcgactcccttactcgataaggattcttctcgagtcggcaatcaga
aactgtgatgagttccaggtcaccgggaaggacgttgagaaaatcctggactgggagaac
agcgcaccaaagcaagtcgaaatcccatttaagccagcccgtgtcctcctccaggatttc
actggtgttccagcagtggttgatcttgcgtgcatgagggatgctatgagcaaacttggc
agtgacccaaacaaaattaatcctctggtacctgtagatcttgttattgatcattcagta
caagttgatgtggcaagatcagaaaatgctgttcaggcaaatatggagctagagttccat
cgtaacaaggagaggtttggatttttgaaatggggttcaactgctttccgtaacatgctt
gttgttccacctggatctggaattgtgcatcaggttaaccttgaatatctggccagagtt
gtgtttaacaatggtgggatcctttaccctgatagtgttgttggaacagactcccacaca
actatgatagatggtcttggtgttgctggatggggagttggtggtatagaggcagaagct
acaatgcttggccagccaatgagcatggtattgccaggagttgtgggcttcaagttaaca
gggaagctgaggaacggtgttactgctacagatttggttctaacagtaactcaaatgctt
aggaaacatggcgttgtcggaaaatttgttgaattttacgggggaggcatgagtgaatta
tcactggctgatagggctacaattgcaaacatgtcaccagaatatggtgcaactatgggt
ttcttcccagttgatggaaagacattggactacttgaagctaactggcagaagtgatgac
actgtggccatgatagagtcttacctgcgtgccaataagatgttcgtcgactacaaccag
cctgaagctgaaagagtgtactcatcttatctggaacttaacttggaggaggtagagcca
tgcttgtctggaccaaaacggcctcatgaccgagtgactttgaagaacatgaaatcagat
tggctgtcttgcttggataatgatgtaggcttcaagggttttgctgtccccaaagaatca
cagggtaaagttgctgagttctctttccatgggacaccagcaaagctaaagcatggtgat
gttgtaattgctgctataaccagttgcaccaacacatcaaatcctaatgtaatgctggga
gctgctttagttgccaaaaaggcttgtgaattaggccttgaggtcaagccatggattaag
acaagtcttgcacctggttctggagttgtgaagaagtacttggacaagagtggtctgcag
aaatatctagaccagcttggcttccatattgtaggctatggttgcacaacctgcatagga
aattctggagaacttgatgaaacagtatctgctgcaatttctgacaacgatattgtcgct
gctgccgtgttatctggaaacagaaattttgaagggcgtgtgcacgcattaaccagagca
aattatcttgcctctcctccattggttgtggcctatgcccttgctggcacggtcaatatt
gattttgagaaagaaccaattggcatctcgaaagatgggaaggaggtttacttcagggac
atctggccttccactgaagagattgctgaggttgttaaatcaagtgtgctacctgacatg
tttaagagcacatacgaggcaataaccaaaggaaatcctatgtggaatgagctgtctgta
tcagcaagcactctctacccatgggacccgacatctacttacatccatgagcctccttat
ttcaaggatatgacaatgtcccctcctggcccacggcctgtgaaggatgcttactgtctc
ctgaactttggtgacagtatcacaactgatcacatctcacctgccggaagtattcaccct
gacagccctgctgctagatatctgaaggagcgtggtgttgaaaggaaggacttcaactca
tatggcagtcggcgaggaaatgatgagatcatggctaggggaacttttgccaacattcgc
cttgtgaacaagttcttgaagggtgaggttggcccaaaaaccatccatattccatcaggg
gagaagctctctgttttcgacgctgctacgaaatacaagaatgaaggacatgacactatt
atcctggctggtgctgagtacggtagtggaagctctcgggattgggctgcgaagggtcca
atgctacagggagtcaaggctgtgattgctaagagctttgaaaggattcaccgcagcaac
cttgctggtatgggtatcattcctctatgcttcaagtcaggggaggacgccgacaccctt
ggattgactggccatgagcgtttcacggttcacctcccggccaatgtaagtgagatcaag
cctgggcaagatgttactgtgacgactgataatgggaagtccttcacttgcacacttcga
tttgacactgaggtggagcttgcatactacgacaatggtggcattttaccgtatgtcatc
agaaagatcgccgagcagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340833
Entry
4340833           CDS       T01015                                 
Name
(RefSeq) putative aconitate hydratase, cytoplasmic
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
osa_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4340833
   00630 Glyoxylate and dicarboxylate metabolism
    4340833
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     4340833
SSDB
Motif
Pfam: Aconitase Aconitase_C KPBB_C
Other DBs
NCBI-GeneID: 4340833
NCBI-ProteinID: XP_015642290
LinkDB
Position
6:11438797..11447744
AA seq 717 aa
MDNTGVPAIVDLAAMRDVMAKLGCDPYQINPLIPVDVVIDHAVRVDVVRSHDALDKNMEL
EFDRNKERFGFLKWASTAFHKMQVFPPGSGIVHQVNLEYLARVVFNADGIMYPDSVVGTD
SHTTMINSLGVAGWGVGGIEAIVAMLGQPMDMVLPGVVGFKLSGMLRDGVTATDLVLTIT
QMLRKHGVVGKFVEFYGVGVGELSLPARATIANMSPEYGASMGFFPVDHVTLDYLKLTGR
SNETVSMIEAYLRANNMFVEHHEPHTERVYSSYLELNLIDVEPCISGPKRPHDRVPLKEM
KSDWHACLDSRVGFKGFAVPRECQDKVVKFDFQGQPAEIKHGSVVLAAICSSTNTSNPSV
IVGAGLVAKKACELGLEVKPWVKTSFTHGSAVTREYLKHSHLQDYLNQQGFHLAAFGCAT
CVGNSGDLDESVSAAITENDIVSVAVLSANRNFEGRVHPLTRANYLASPPLVVAYALAGT
VDIDFEKEPIGHGKDGNEVYLRDIWPTNEEIEQVVKSSVLPHMFTQTYESIKRCNRRWNE
LRVPGEAAALYPWDPSSTYIRKPPYLEGMAMSPPSRPRSVRDAYCLLNLGDSVTTDHISY
SGSITPGSAAAEYLRAAGVADRERLGSYGGRRGNDEVVVRGAFANARIVNKLMNGKVGPK
TVHVPTGEELCVFDAAIKYKSEGHNMVIVIAGAEYGSGSSRDSAAKGPMLLKNLRAA
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggacaacactggagtcccggcaattgtagaccttgcagctatgcgcgatgtgatggca
aagttaggctgtgatccataccagatcaatccattgattccagtggatgttgttattgac
catgcggtgcgagtggatgttgtgagatcgcacgatgcattggataaaaacatggagctg
gagtttgaccgcaacaaagaaaggtttggtttccttaaatgggcatccactgcttttcac
aagatgcaggttttccctcctggttctggtattgtgcaccaggtaaatcttgagtatctt
gcccgagttgtgttcaacgcagatggcatcatgtatcctgacagcgtggttggcactgac
tcacacaccactatgattaatagtcttggggttgctggttggggagttggtggtattgaa
gcaattgttgcaatgcttgggcagccaatggacatggttttacctggtgttgttgggttc
aagttgtctggaatgttgcgggatggtgtcactgctactgaccttgttcttacaatcact
caaatgctaaggaagcatggtgttgttggcaaatttgttgaattttatggtgtgggtgtg
ggtgagctgtctttgcccgctagggccacaattgcaaatatgtctccagaatatggagct
agcatgggcttcttccctgtggaccatgttacgctggattatctcaaactgacaggccga
agcaacgaaactgtgtcaatgattgaagcatatctgcgagctaacaatatgtttgtggag
caccatgagcctcatacagaacgagtttattcttcatatcttgagctcaaccttatagat
gtggagccttgcatttcaggcccaaagaggcctcatgaccgtgtccctttgaaggaaatg
aaatcagattggcatgcttgcctagacagcagagttggtttcaagggttttgcagttcca
agggagtgccaggataaagttgtgaaatttgactttcaaggacaacctgctgaaatcaag
catggcagtgttgttcttgcagcaatatgcagttccacaaacacatcaaatcctagcgtt
atagttggtgctggccttgttgcaaagaaagcctgtgaattgggccttgaggtgaagcca
tgggtaaagactagctttacccatggatctgcggttacccgtgaatacttgaaacacagt
caccttcaagattatttgaaccagcaagggtttcatcttgctgcatttggctgtgccacc
tgcgtcggcaactctggtgaccttgatgaatctgtatcagctgccataacagaaaatgat
attgtctctgttgctgtgctgtcggcaaaccgtaactttgagggtcgcgtgcaccctctg
actcgggctaattaccttgcctcgccacctctggttgttgcctatgcccttgctggcact
gttgacattgattttgagaaagaacccattggacatggaaaggatggcaatgaagtttac
ttgagggacatatggcccacaaacgaagaaatcgaacaggttgtgaaatccagtgtgcta
cctcacatgttcacgcaaacgtacgaatccatcaagagatgcaaccggaggtggaacgag
ctgagagttccaggcgaggcagctgccctctacccatgggacccgagctcgacctacatc
cgcaagccgccctacttggagggcatggccatgtccccgcccagccgcccacgctcggtg
agggatgcctactgcctgctcaacctgggggactccgtcaccacggaccacatctcctac
tccgggagcatcacgcccggcagcgccgccgctgagtacctacgcgccgccggcgtcgcg
gatcgggagaggctcggctcctacggtggccggcgtggcaacgatgaggtggtggtgagg
ggcgcgtttgcaaacgcgaggattgtgaacaagcttatgaatgggaaggttggacccaag
actgttcatgttcccaccggggaggaactctgtgtctttgatgcagccataaaatacaaa
tccgagggtcacaatatggtaattgttattgctggtgctgagtatgggagtggcagttct
cgtgactctgctgccaaggggccaatgctcctgaagaatctaagagcagcctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270306
Entry
9270306           CDS       T01015                                 
Name
(RefSeq) putative aconitate hydratase, cytoplasmic
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
osa_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    9270306
   00630 Glyoxylate and dicarboxylate metabolism
    9270306
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     9270306
SSDB
Motif
Pfam: Aconitase Aconitase_C Acyl_transf_2 HypD
Other DBs
NCBI-GeneID: 9270306
NCBI-ProteinID: XP_015650034
LinkDB
Position
8:complement(5327636..5334946)
AA seq 991 aa
MYKAAYSSASARLSSSLLRFRSLPSPAPSSSLSRLLSLRARAFSRPSRGGWAAAGGWSGR
ASSSPVVGCGACRAQIGAVAPAVERVHRRMAATAAAEHPFKNILTTLPKPGGGEYGKFYS
LPALNDPRIDKLPYSIRILLESAIRNCDNFQVNQNDVEKIIDWENTSPKLAEIPFKPARV
LLQDFTGVPAVVDLAAMRDAMAKLGSDANKINPLVPVDLVIDHSVQVDVARSPNAVQSNM
ELEFKRNNERFGFLKWGSTAFHNMLVVPPGSGIVHQVNLEYLGRVVFNTDGIMYPDSVVG
TDSHTTMIDGLGVAGWGVGGIEAEATMLGQPMSMVLPGVVGFKLTGKLQNGVTATDLVLT
VTQMLRKHGVVGKFVEFYGEGMGKLSLADRATIANMSPEYGATMGFFPVDHVTLDYLKLT
GRSDETVAMIEAYLRANKMFVDYNEPQTERVYSSYLELDLNEVEPCISGPKRPHDRVLLK
EMKSDWHSCLDNRVGFKGFAVPKEQQDKVVKFDFHGQPAELKHGSVVIAAITSCTNTSNP
SVMLGAALVAKKACELGLEVKPWVKTSLAPGSGVVTKYLLQSGLQEYLNKQGFHVVGYGC
TTCIGNSGDLDESVSAAISENDVVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALA
GTVDIDFEKEPIGVGKDGKEVFFRDIWPSTEEIAEVVQSSVLPDMFKSTYEAITKGNPMW
NQLTVPEASLYSWDPNSTYIHEPPYFKDMTMSPPGPHGVKNAYCLLNFGDSITTDHISPA
GSIHKDSPAAKYLLERGVDRKDFNSYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTV
HVPTGEKLYVFDAALKYKSEGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFER
IHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYTIDLPTNVSEIRPGQDITVTTDNGKSF
TCTLRFDTEVELAYFNHGGILPYVIRNLAQN
NT seq 2976 nt   +upstreamnt  +downstreamnt
atgtataaagcggcatactcctccgcctccgcccgcctctcctcctccctcctccgcttc
agatccctcccctctcccgctccctcctcctcgctgtcgcgcctcctctccctcagggca
cgcgcgttctcgcggccgtcgcgcggcgggtgggcggcggcgggcggttggtccgggagg
gcgtcgtcgtcgccggtcgtcgggtgcggcgcctgcagggcgcagatcggggccgtcgcg
cctgccgtcgagcgcgtccaccgcaggatggccgccaccgcagctgctgagcatcccttc
aagaacattttgaccaccctccctaagcctgggggtggtgaatatgggaaattctacagc
cttcctgcactaaatgatcccaggattgataagctgccctactctatccgtattcttcta
gagtcagctatccgcaactgtgataacttccaagtcaaccagaatgatgttgagaaaatt
attgattgggagaatacatctcccaagctggctgaaatacctttcaagccagcacgagtt
cttcttcaggacttcactggagttccagctgtcgtagatcttgcagctatgcgtgacgcg
atggccaagttgggcagtgatgccaacaagatcaatccactggttccagtggatcttgta
attgaccactcagtgcaggtggatgttgcaaggtcaccaaatgctgtgcaatcaaacatg
gagttggagtttaagcgtaacaatgaaagatttggtttccttaaatggggttctactgct
ttccacaatatgttggttgtaccccctggttcaggaattgtgcaccaggtcaatcttgag
tatcttggtcgagttgttttcaacacagatggaattatgtatcctgacagtgtggttggt
accgattcacacaccactatgattgatggtttgggtgttgctggttggggagttggtgga
attgaagcagaggccacaatgcttggtcagccaatgagcatggttttgcctggtgttgtt
gggttcaagttgactgggaagttacagaatggtgtcactgctaccgaccttgttcttact
gtcacccaaatgttaaggaagcacggcgttgttggcaaatttgttgaattctatggcgaa
ggcatgggaaagctttctttggctgacagggccacaatcgcaaacatgtcacctgaatat
ggagccacaatgggtttcttccctgtagaccacgtgacactagattatcttaaattgact
ggccggagtgatgaaactgtggcaatgattgaagcatatctgcgagctaacaagatgttt
gtagactacaatgagcctcaaacagaaagggtttactcttcgtatcttgagttggatctt
aatgaggtggaaccttgcatttcaggcccaaagaggcctcatgaccgtgtccttttgaag
gaaatgaaatctgactggcattcttgcctggataacagagttggtttcaagggttttgct
gtaccaaaggaacaacaagataaagttgtgaaatttgacttccatggacaacctgctgaa
ctcaaacatggcagtgttgtcatagcagcaattactagctgcacaaacacatcaaatcct
agtgttatgcttggtgctgcccttgtggcaaagaaagcctgtgaactgggtcttgaggtg
aaaccatgggtaaagacaagccttgcccctggatctggggttgtcactaaatacttgtta
cagagtggccttcaagaatacttgaacaagcaaggtttccatgttgttggatatggttgt
accacttgcattggcaactctggtgatctagatgaatctgtatcagctgccatttcagaa
aatgatgttgttgctgctgctgttctgtcgggcaaccgtaacttcgagggtcgtgtgcac
ccattgacccgggctaattaccttgcttcaccgcctcttgtggttgcatatgcacttgct
ggcactgttgacattgattttgagaaagagccgattggagttggaaaggatggtaaagaa
gtcttcttcagggacatatggccctcaactgaagaaattgcagaagtggtccaatctagc
gtactgcctgatatgttcaaaagtacatacgaggctattacaaaaggcaacccgatgtgg
aatcagctgaccgtgcccgaagcatcgctctattcgtgggatccaaactccacctacatc
catgagcctccatactttaaggacatgaccatgtccccacctggcccccatggggtgaag
aatgcctactgcttactgaactttggggacagcattacgacagaccatatttcaccagca
ggtagcattcacaaagacagccctgctgccaagtacttgcttgagcgtggtgtggaccgt
aaggacttcaattcatatggtagccgtcgtggtaatgatgaagtaatggcaagaggaaca
tttgcgaacatcaggattgtgaacaagtttttgaatggagaagttggacccaagaccgtt
catgtccctacaggggagaagctctatgtatttgatgctgccttgaaatacaagtctgag
ggtcatgacactattgttcttgctggtgctgagtatggaagtggcagttctcgtgactgg
gctgccaagggaccgatgctcctgggtgttaaagctgtgatcgctaagagctttgagcgt
atccaccgaagcaacctggtgggtatgggaatcattcctctctgcttcaaggctggtgag
gatgccgactcacttggccttactggacatgagcggtataccatcgacctcccgaccaac
gtcagcgagatccgtcccgggcaggacattaccgtcacaaccgacaacgggaaatccttc
acttgtactcttcgctttgacacagaggtggaactggcatacttcaaccatggaggcatc
ctcccatacgtcatccgcaacctggcgcagaactag

DBGET integrated database retrieval system