KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331792
Entry
4331792           CDS       T01015                                 
Name
(RefSeq) adenylosuccinate synthetase 1, chloroplastic
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00250  Alanine, aspartate and glutamate metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4331792
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4331792
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     4331792
SSDB
Motif
Pfam: Adenylsucc_synt BAG6 RskA
Other DBs
NCBI-GeneID: 4331792
NCBI-ProteinID: XP_015631824
UniProt: Q10R17 V5K4U2
LinkDB
Position
3:complement(3986797..3990003)
AA seq 488 aa
MSLSTVNHAAAAAAAAAGPGKSFSAAAPAAPSVRLPRTRAPAAAAVSAAAVGADRAADRV
SALSQVSGVLGSQWGDEGKGKLVDVLAPRFDIVARCQGGANAGHTIYNSEGKKFALHLVP
SGILHEGTLCVVGNGAVIHVPGFFNEIDGLESNGVNCNGRILVSDRAHLLFDLHQAVDGL
REAELANSFIGTTKRGIGPCYSSKVTRNGLRVCDLRHMDTFGDKLDVLFKDATSRFEGFE
YSKSMLREEVERYKRFAERLEPFIADTVHLLNESIQQKKKILVEGGQATMLDIDFGTYPF
VTSSSPSAGGICTGLGIAPRCIGDLIGVVKAYTTRVGSGPFPTELFGEEGDLLRKSGMEF
GTTTGRPRRCGWLDIVALKYCCEINGFSSLNLTKLDVLSGLPEVKLGVSYNQPDGQKLQS
FPGDLDTLEQVQVKYEVLPGWQSDISSVRSYSELPLAAQRYVERIEELVGVPVHYIGVGP
GRDALIYK
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgtcgctctccactgtcaaccacgccgccgccgccgccgccgccgcagcggggccgggg
aaatccttctccgcggctgcgcctgcggcgccatcggtgcgcctgccaaggacacgggct
cctgctgccgccgcggtgtccgcggcggctgtgggggcggaccgcgcggcggacagggtg
tcggcgctgagccaggtctccggggtgctggggtcgcagtggggcgacgaggggaagggg
aagctcgtcgacgtgctcgcccctcgcttcgacatcgtcgcgcgttgccagggcggagca
aatgctggacacaccatttacaattctgaaggaaagaaatttgctcttcatcttgttcca
tctggtattctccatgaaggaacgctgtgtgttgttggcaatggagcggtgatccatgtt
ccaggattttttaatgaaattgatggtcttgaatccaatggagtcaattgcaatggaaga
atattggtctctgaccgggcacatttactctttgatctgcatcaggctgtagatggactt
agggaagcagagcttgctaattcctttatagggacgactaagagaggcattggaccatgt
tattccagcaaggtcactcgaaacggactgcgagtctgtgatctaaggcacatggacact
tttggggataagcttgatgtcttgtttaaagatgccacttcaaggtttgaaggctttgag
tacagcaaaagcatgctcagggaagaggttgagaggtacaaaagatttgcagagcgcttg
gagccgttcattgctgatactgttcatctgttgaatgaatctatccaacagaagaagaaa
attctggttgaaggtggtcaagcaacaatgttggatattgattttggaacttacccattt
gtgacttcttctagcccttcagctggtgggatatgcactggccttgggattgccccaagg
tgtattggtgacctgattggagtggtaaaagcttatacaacaagggttggttctgggcct
tttccaactgaactgtttggagaggaaggtgatctccttaggaaatcaggaatggaattt
gggacgacaacaggccgcccaaggcgttgtggctggcttgacattgttgcactaaagtac
tgctgcgagataaatgggttttcatctcttaatctgaccaaacttgatgttctgtctgga
ttaccagaagttaagctgggggtttcttataaccaacctgatgggcagaagctacaatcc
ttcccaggggatcttgatactctggagcaagtacaggtcaaatatgaggtgttgcctggg
tggcaaagtgacatttcgtctgtccggagttacagtgaacttcccctagctgcccaacgc
tatgtcgagaggatagaagagcttgttggtgttccagtccactacattggtgttggacct
gggagggatgctctaatatacaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333815
Entry
4333815           CDS       T01015                                 
Name
(RefSeq) adenylosuccinate synthetase 2, chloroplastic
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00250  Alanine, aspartate and glutamate metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4333815
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4333815
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     4333815
SSDB
Motif
Pfam: Adenylsucc_synt
Other DBs
NCBI-GeneID: 4333815
NCBI-ProteinID: XP_015631172
UniProt: Q851S8
LinkDB
Position
3:28035478..28039101
AA seq 489 aa
MPFSPPCLDPAAAAAASLSFLPAAAARPPAPCAVAPRSRRALRVAASVATAPESAAAQGR
LESLSQVAGVLGTQWGDEGKGKLVDILAQRFDIVARCQGGANAGHTIYNSEGKKFSLHLV
PSGILNEKTMCVVGNGAVVHLPGFFKEIDGLESNGISCEGRILVSDRAHLLFDFHQTVDG
LREVELGNSLIGTTKRGIGPCYSNKVIRNGLRVSDLRHMDTFGAKLNTLLRDAALRFEGF
EYSTKTLKEEVEKYEKFAERLGPYITDTVHFMNQSILQNKKILVEGGQATMLDIDFGTYP
FVTSSSPSAGGICTGLGIAPRSIGDLIGVVKAYTTRVGSGPFPTELLGKTGDLLRASGME
FGTTTGRPRRCGWLDIVALKYCCQINGFSSLNLTKLDVLTGLKEVKLGIAYCTEDGKEIE
SFPADLDLLEKIKVKYEVLPGWEDDISSVRNYSDLPETARLYVERIEELVGIPVHYIGVG
PGRDALIYK
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgccattctcccctccgtgcctggaccccgccgccgccgccgccgcctccctctccttc
ctccccgccgccgccgcgaggccaccggcgccatgcgcggtggcgccgcgctcgcgccgg
gcgctgagggtggcggcatccgtggccacggccccggagtcggcggccgcgcaggggcgg
ctggagtcgctgagccaggtggccggggtgctgggcacgcagtggggcgacgaggggaag
ggaaagctcgtcgacatcctcgcgcagcgcttcgacatcgtcgcacgctgccagggtgga
gctaatgctgggcatactatatataattcagagggaaagaagttttcattacatcttgtt
ccatcaggtatcctcaatgagaagacaatgtgtgtagttggtaatggagcagtagttcat
cttcctgggttcttcaaagaaattgatgggttagaatcaaatggaatttcctgtgaagga
agaattttagtatcagatcgtgcccatcttttgtttgactttcatcaaactgttgacggg
ctcagagaggtagagcttggaaattcccttataggaacaacaaagaggggaattgggcca
tgctattcaaacaaagttataaggaatggacttagagtcagtgatctgcggcatatggat
acatttggtgctaaactcaataccttgctgagagatgcagctctgcgctttgaaggattt
gaatacagtaccaagacccttaaagaggaggttgagaagtacgaaaagtttgccgagcgt
ctaggaccttatattactgataccgtgcacttcatgaatcaatcaatcttgcagaataag
aaaatattggttgaaggtggtcaagccaccatgttagacattgactttggtacttaccca
tttgttacttcctcgagtccctcagctggtggtatttgcactggccttggtattgctcct
agaagtatcggtgatctcattggagtggtaaaagcttacacaaccagggtaggttctggc
ccattcccaacagagctgttgggtaagactggtgatttgctccgcgcttctggaatggag
tttgggacaacgacaggtcgaccgaggcgctgtggctggcttgatatagttgcactcaag
tactgctgccaaataaacggtttctcatctttaaatctgaccaaactcgacgtgttaact
ggcctcaaggaagtaaagctgggaattgcatattgtactgaagatggtaaagaaattgaa
tcattccctgcagaccttgatcttctggagaaaattaaggtcaaatatgaggttctacct
gggtgggaggacgacatttcctctgtacgaaactacagcgatctcccagagactgctcgt
ttgtacgtggagaggatagaagagctggttggtatcccagtccattacatcggcgtagga
ccagggcgtgatgctctcatatacaaatag

DBGET integrated database retrieval system