KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331798
Entry
4331798           CDS       T01015                                 
Name
(RefSeq) omega-amidase, chloroplastic
  KO
K13566  omega-amidase [EC:3.5.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4331798
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.3  omega-amidase
     4331798
SSDB
Motif
Pfam: CN_hydrolase AP_endonuc_2
Other DBs
NCBI-GeneID: 4331798
NCBI-ProteinID: XP_015627835
LinkDB
Position
3:4024314..4028512
AA seq 351 aa
MRATAAAAFSLLTCSCLRSTSPTRLPSSSLRLPLRRGPLAAMATAASFRPEAARSPPAVQ
PPAPPLSKFKVALCQLSVTADKARNIARAREAIEAAAAGGAKLVLLPEIWNGPYSNDSFP
EYAEDIEAGGDAAPSFSMMSEVARSLQITLVGGSISERSGNKLYNTCCVFGSDGELKGKH
RKIHLFDIDIPGKITFKESKTLTAGQDLTVVDTDVGRIGIGICYDIRFQELAMLYAARGA
HLLCYPGAFNMTTGPLHWELLQRARAADNQLFVATCAPARDTSAGYIAWGHSTLVGPFGE
VIATAEHEETTIMAEIDYSLIDQRRQFLPLQYQRRGDLYQLVDVQRSGSDE
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgagagccacagccgcagccgccttctcactcctcacctgctcctgtctccggagcacc
agcccgaccaggctcccctcctcctcgctccgcctcccgctccgccgcggcccgctcgcc
gcgatggccacggccgcctccttccgcccggaggccgcgcggtcgcctcccgccgtccag
cccccggcgccgccgctctccaagttcaaggtggcgctgtgccagctgtcggtcacggcg
gacaaggctcgcaacatcgcgcgggcgcgcgaggccatcgaggctgccgcggcgggcggc
gccaagctcgtgcttctcccggagatatggaatggtccatattcaaatgacagctttcca
gaatatgccgaagacatcgaagccggtggtgatgcagctccttcattttcaatgatgtca
gaggttgctcgcagcttgcaaattactcttgttggtggatccatatcagaacgttctggt
aacaagttgtacaatacatgctgtgtctttggttcagatggcgagcttaagggcaagcac
agaaagatccatctttttgacattgacattcctggaaagattacattcaaggaatcgaag
actcttactgctgggcaggatcttactgttgtagacacagatgtaggccggattggtata
ggtatttgttatgacattcgtttccaggaattggcaatgttgtatgctgcgagaggtgct
catttgttatgctatcccggtgcatttaacatgactacagggccattgcactgggagttg
ctgcaaagggcaagggctgcagacaatcagctgtttgtggcaacctgtgcaccagctcga
gacaccagtgcaggttatattgcttggggacattccactcttgttggaccttttggggaa
gtgattgctaccgctgagcatgaggagaccactataatggcagaaattgattattcattg
attgatcagaggaggcaatttcttcctctgcaatatcaacgccggggcgatctctatcag
ttggtagatgtccagagatccggctctgatgagtag

DBGET integrated database retrieval system