KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331828
Entry
4331828           CDS       T01015                                 
Name
(RefSeq) proteasome subunit alpha type-6 isoform X2
  KO
K02730  20S proteasome subunit alpha 1 [EC:3.4.25.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4331828
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4331828
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4331828
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     4331828
Peptidases and inhibitors [BR:osa01002]
 Threonine peptidases
  Family T1: proteasome family
   4331828
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    4331828
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 4331828
NCBI-ProteinID: XP_015630351
UniProt: Q9LSU3
LinkDB
Position
3:complement(4210508..4213006)
AA seq 246 aa
MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL
LDHTSVTHLFPITKYIGLLATGLTADARSLVYQARNEAAEFRFKWGYEMPVDVLAKWIAD
KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE
KKMKDDPQFSYEETVQIAISALQSVLQEDFKATEIEVGVVRKDDRVFRALTTEEIDQHLT
AISERD
NT seq 741 nt   +upstreamnt  +downstreamnt
atgagccgcggcacgggcgccggctacgaccgccacatcaccatcttctccccggagggc
cgcctctaccaagtcgagtacgcgttcaaggcggtgaagtcggcgggggtgacgtcgatc
ggcgtccgcggcaaggactccgtctgcgtcgtcacacagaagaaagtgccggacaagttg
ctggaccatacgagcgtcacgcacttgttcccgatcaccaagtacatcggtctgctcgcc
actggcctcacagctgatgcaaggtccttagtctaccaagcaaggaatgaggcagctgaa
ttccgtttcaaatggggctacgagatgcccgtagacgtattagcaaaatggatagcagac
aaagcacaagtctacacgcagcatgcctacatgaggccccttggagtagttgctatggtc
ttgggctatgacgaagagaaaaacgctcaactattcaaatgtgacccggcaggtcacttc
tttggacataaggcaactagcgccggtcttaaggagcaggaagcaataaattttctggag
aagaaaatgaaggatgacccacagttctcctacgaggaaactgtccagattgcaatttct
gcattgcaatcagttcttcaggaagatttcaaggccaccgagattgaggtcggtgttgtg
aggaaagatgatcgtgttttcagagcactcacgacagaggagatcgatcagcacctaaca
gccataagtgagcgcgactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343891
Entry
4343891           CDS       T01015                                 
Name
(RefSeq) proteasome subunit alpha type-6
  KO
K02730  20S proteasome subunit alpha 1 [EC:3.4.25.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4343891
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4343891
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4343891
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     4343891
Peptidases and inhibitors [BR:osa01002]
 Threonine peptidases
  Family T1: proteasome family
   4343891
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    4343891
SSDB
Motif
Pfam: Proteasome Proteasome_A_N APG6
Other DBs
NCBI-GeneID: 4343891
NCBI-ProteinID: XP_015644554
UniProt: A0A5S6R6K1 Q94II8
LinkDB
Position
7:complement(25289729..25293788)
AA seq 253 aa
MPEAEAAAVVTGGGSRAAGPADYERFITLFSPEGRLCQLDYAFNAVKLAGITSVGVRGDD
SVYVLTHRKEDKLHDPTTITNLFAITDRIGLLATGMPGDGRAIAQEARNAAAEFRFKWGY
KMSPCMLAQWIADRAQIRTQHAQIRPYGVVSMIFGIDEEKGTPELFTCDPAGQFFAHKAT
SAGPKEKEVMNFLEERMKSKPSLSSGTTKGLAKSALKHVLEGDFYAREFELGFIKKGDPT
VTLHPVKFKRTRR
NT seq 762 nt   +upstreamnt  +downstreamnt
atgccggaagccgaggccgcggcggtggtcaccggaggcggcagccgcgccgccggcccc
gccgactacgagcgcttcatcaccctcttctccccggagggccgcctctgccaactcgac
tacgcgttcaacgccgtgaagctggccgggatcacctccgtcggcgtgcgcggcgacgac
tccgtctacgtcctcacccatcggaaggaggacaagttgcacgacccgacgaccatcacg
aacctgttcgcgatcaccgaccggattgggctgctcgccaccgggatgccaggtgatgga
agggcaatagctcaggaggcaaggaacgcagctgccgagtttcgcttcaagtggggatat
aaaatgtctccttgtatgttagctcaatggattgcagacagagcacagatccgcacccag
catgctcagataagaccttatggagttgtttctatgatctttggaattgatgaagagaaa
ggaacccccgagctcttcacatgtgatccagctggacaattctttgcacacaaggccaca
agtgctggtccgaaagagaaggaagttatgaactttcttgaggaaagaatgaagagcaaa
ccttctctatcatctggcacaacaaaagggttggcaaaatctgcgttgaaacatgtcctg
gagggggatttctatgcccgagaatttgagcttggatttatcaagaaaggggatccaact
gtaactctgcacccagtgaaattcaagcgcacgcggaggtga

DBGET integrated database retrieval system