KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331869
Entry
4331869           CDS       T01015                                 
Name
(RefSeq) uroporphyrinogen-III synthase, chloroplastic
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4331869
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     4331869
SSDB
Motif
Pfam: HEM4 UPF0180
Other DBs
NCBI-GeneID: 4331869
NCBI-ProteinID: XP_015630608
UniProt: Q10QR9
LinkDB
Position
3:4496691..4500863
AA seq 302 aa
MALSSSSHLLPFSRPPATFPRARHAGGGRGRAGATGRFIACSSPPPPDVVVTRERGKNAK
LIAALEKHNVQSLELPLIKHVEGPDTDRLSAVLRDEKFDWITITSPEAAAVFLEGWKAAG
NPKVRIAVVGAGTERVFDEVIQYNDGSLEVAFSPSKAMGKFLASELPRTTETTCKVLYPA
SAKAGHEIQNGLSNRGFEVTRLNTYTTVSVQDVDPLILKPALSAPVVAVASPSALRAWLN
LASQVDNWGNAIACIGETTASAAKKFGLKSIYYPTTPGLDGWVESILEALRAHGQSKEAP
GC
NT seq 909 nt   +upstreamnt  +downstreamnt
atggccttgtcctcctcttcgcacctcctccccttctcccggcctcccgcgaccttccca
cgagcacgccacgccggcggcgggaggggccgagccggcgccacggggaggttcatagcg
tgctcctcgccccctcctcccgacgtcgtggtcacccgcgagcgcgggaagaacgccaag
ctcatcgccgcgctggaaaaacataatgtacaaagtcttgagcttcctcttattaaacat
gttgaagggccagatacagataggctttctgctgtcctgcgcgatgaaaagtttgactgg
atcactataacatctcctgaggcagctgctgtgttccttgagggatggaaggctgctgga
aatcctaaggtacgaatagcggttgttggagcaggtactgaaagagtttttgacgaagta
attcaatacaatgatggatcccttgaggttgcattttctccttctaaagctatgggtaaa
tttttggcctcagagcttccaaggaccactgaaactacttgtaaagtgttatatcctgca
tctgcaaaggctggccatgaaatccagaatgggctatcaaatcgaggatttgaggtgaca
agactgaacacatatacaactgtatctgtacaggatgtcgatccgctaatattaaagcct
gctctttcagctccagttgttgcagtagcttctccttctgctctccgagcttggctaaat
cttgcttcacaagttgacaactggggcaacgccattgcctgcataggcgagacgactgcc
tcagcagctaagaaatttggcctgaagagcatatattatcctaccaccccgggacttgac
gggtgggttgaaagcatccttgaagcgctcagagcccatgggcaatcgaaagaggcccca
gggtgttga

DBGET integrated database retrieval system